DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pita and CG14655

Sequence 1:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_649494.1 Gene:CG14655 FlyBaseID:FBgn0037275 Length:525 Species:Drosophila melanogaster

Alignment Length:605 Identity:128/606 (21%)
Similarity:209/606 (34%) Gaps:172/606 (28%)


  Fly    11 MLTEKRVCRFCLTEQKLASIFEENPRVKTTANLPLQIMAITAIEVYAG-DGMPGHICLECRLLFE 74
            |.:...:|..|.. ....||.....|:...||.||........|::.| |.:..|       ||.
  Fly     1 MCSTSVLCPLCAV-PSFGSIDALQQRLIKAANGPLACPFANCKELFLGLDKLTIH-------LFS 57

  Fly    75 HCYRFKQMCKRAETLLRQYPLTGNWPSPLEKPRAPMTMVASKKLLVVPAKTAEPSETPKKLLNTM 139
            |           .:|:.|   .||......:|.:....:|:          |.|....|:   |.
  Fly    58 H-----------TSLMAQ---EGNESPANGQPASSRGFLAA----------APPKRRAKR---TR 95

  Fly   140 AKSSSQVIIEDVQVLESAMVTPRTVAGSSPVPRRSHAYELKVDNNQELSMDDVQSMLEDMASELE 204
            :|              ..:.||..|..:.|.......:..:   |.||....|:.:.|:...|.:
  Fly    96 SK--------------PVVPTPPPVRTTPPAHCDICEFSFR---NTELRDMHVRLVHENAEGEPK 143

  Fly   205 KEFPDIPQKASPVKPKVLN--------KSSIRILNK--------------------GPAAPVEPR 241
            ::.|.  ||....:|...:        |.|:||..|                    .||:.....
  Fly   144 QKEPQ--QKEPDQEPYKCHLCSKTFRMKGSLRIHLKVVHMMGVPCSNPNPNPNPSPTPASTTSAV 206

  Fly   242 LATPKVKRDD-----------SGNVAIVTE----VLDSDLPLDDQDDPTKNAEKVATDVFPCPDC 291
            .||||:...|           :||.:..|.    .|...|.: .|..|:......||        
  Fly   207 TATPKLSICDRIRHTEPGALGNGNNSTCTASQPYALSGALSM-LQQSPSSPESGTAT-------- 262

  Fly   292 ERSFPLQQLLEIHRLNHTRSRSFQCLLCEKSFFSKYDLAKHNFVHTGERPFKCAICSKAFTRKAL 356
                               .:.::|.:|.|||.:||.|.||..:||||.|:.|.||::.||.:..
  Fly   263 -------------------PKLWECDVCSKSFTTKYFLKKHKRLHTGEMPYTCEICARTFTFQQS 308

  Fly   357 LHRHERTHTDVPKFICVYCEKPFLSRQEMEKHAERHQKKRPFQCGVCTKSFAFKQGLERHETVHS 421
            .|:|...|::|...:|..|.:.|.....:..|...|..::||:|.||.|.|..:.....|..:|:
  Fly   309 YHKHLLYHSEVKPHVCGVCGRAFKELSTLHNHQRIHSGEKPFKCEVCGKCFRQRVSFLVHTRIHT 373

  Fly   422 TNLPFPCQHCERSFSTASKLARHLVAHAGKRAYPCKYCHKSYMLSHHLSRHLRTHTQTSDASFVC 486
            ..:|:.|:.|:::|       |:.|:....|. |.:.......|.........:|||.|.||   
  Fly   374 GVMPYKCELCQKTF-------RYKVSQRTHRC-PTEEAQTPEQLIKAFLEGNDSHTQPSPAS--- 427

  Fly   487 SECKVSYSNYNDLLD---HALIHATASLKCPMCRKQIEDIDSVESHMDQHKQSERHACEFCDHIF 548
              .:::..|.:.::|   .||:           .:.|:||                ..|.|..:.
  Fly   428 --AEIAAINSSSIVDPEQEALL-----------SQSIDDI----------------VVEQCQKLG 463

  Fly   549 LTQKCLQRHIEDDHVVEMEP 568
            :   |.....|:..::.::|
  Fly   464 I---CGVEPREEGQLISLQP 480

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871 17/76 (22%)
COG5048 <281..506 CDD:227381 59/228 (26%)
C2H2 Zn finger 288..308 CDD:275368 0/20 (0%)
C2H2 Zn finger 316..336 CDD:275368 10/20 (50%)
zf-H2C2_2 328..353 CDD:290200 13/25 (52%)
C2H2 Zn finger 344..364 CDD:275368 7/20 (35%)
C2H2 Zn finger 372..388 CDD:275370 3/16 (19%)
C2H2 Zn finger 400..420 CDD:275368 6/20 (30%)
C2H2 Zn finger 428..448 CDD:275368 5/20 (25%)
C2H2 Zn finger 456..476 CDD:275368 1/20 (5%)
C2H2 Zn finger 486..506 CDD:275368 4/23 (17%)
HARE-HTH <566..625 CDD:294801 1/4 (25%)
CG14655NP_649494.1 C2H2 Zn finger 268..288 CDD:275368 10/20 (50%)
zf-H2C2_2 281..304 CDD:290200 12/23 (52%)
C2H2 Zn finger 324..344 CDD:275368 4/20 (20%)
zf-H2C2_2 339..361 CDD:290200 9/22 (41%)
C2H2 Zn finger 352..372 CDD:275368 6/20 (30%)
zf-H2C2_2 364..389 CDD:290200 7/32 (22%)
C2H2 Zn finger 380..396 CDD:275368 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.