DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pita and CG17359

Sequence 1:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_648679.1 Gene:CG17359 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster

Alignment Length:425 Identity:107/426 (25%)
Similarity:164/426 (38%) Gaps:129/426 (30%)


  Fly    16 RVCR---FCL----TEQKLAS--IFEENPRVKTTANLPLQIMAITAIEVYAGDGMPGHICLECRL 71
            ||||   .||    ||...:|  :.|:.|.:.|      .:...:...|:..||||..||:||..
  Fly     8 RVCRDESDCLLDIYTEPYASSNRVQEQEPVLAT------MLRECSGCSVHKEDGMPQFICVECAE 66

  Fly    72 LFEHCYRFKQMCKRAETLLRQYPLTGNWPSPLE---------KPRAPMTMVASKKLLVVPAKTAE 127
            ...:.||.::.|:::.....|..|.......:|         :|:.|::::             |
  Fly    67 AVRNAYRLRRQCRKSHQYFEQLRLMMKELDDIEYCLNIGDNIEPQMPVSVM-------------E 118

  Fly   128 PSETPKKLLNTMAKSSSQVIIEDVQVLESAMVTPRTVAGSSPVPRRSHAYELKVDNNQELSMDDV 192
            ..:||        ::|..:::|.|||   ..:.|.....|||:|          |||:.      
  Fly   119 AGKTP--------ETSEPLLVELVQV---KYMPPEPKPISSPLP----------DNNEH------ 156

  Fly   193 QSMLEDMASELEKEFPDIPQKASPVK-PKVLNKSSIRILNKGPAAPVEPRLATPKVKRDDSGNVA 256
                            .:.|..||.| |.  |||..|..:........|                
  Fly   157 ----------------KLAQSYSPAKTPH--NKSKRRARSYSDNDSWSP---------------- 187

  Fly   257 IVTEVLDSDLPLDDQDDPTKNAEKVATDVFPCPDCERSFPLQQLLEIHRLNHTRSRSFQCLLCEK 321
                  ||:|..:| ||...||.|            |..|.:.           ...::|.||.:
  Fly   188 ------DSELEHED-DDKIWNASK------------RGKPKRV-----------PGPYRCKLCTQ 222

  Fly   322 SFFSKYDLAKHNFVHTGERPFKCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEME 386
            ||..|.:|..|..:||||||:||::|.::|.:|..|..|.|.||....|.|..|.|.|....:::
  Fly   223 SFTQKQNLEIHMRIHTGERPYKCSLCPRSFAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQLQ 287

  Fly   387 KHAERHQKKRPFQCGVCTKSFAFKQGLERHETVHS 421
            .|...|..::||:|..|.:||....||::|.:.|:
  Fly   288 VHTRTHTGEQPFKCSKCQQSFKQLNGLQKHMSAHT 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871 23/84 (27%)
COG5048 <281..506 CDD:227381 43/142 (30%)
C2H2 Zn finger 288..308 CDD:275368 2/20 (10%)
C2H2 Zn finger 316..336 CDD:275368 8/20 (40%)
zf-H2C2_2 328..353 CDD:290200 12/25 (48%)
C2H2 Zn finger 344..364 CDD:275368 7/20 (35%)
C2H2 Zn finger 372..388 CDD:275370 4/16 (25%)
C2H2 Zn finger 400..420 CDD:275368 7/20 (35%)
C2H2 Zn finger 428..448 CDD:275368
C2H2 Zn finger 456..476 CDD:275368
C2H2 Zn finger 486..506 CDD:275368
HARE-HTH <566..625 CDD:294801
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 25/86 (29%)
zf-C2H2 215..237 CDD:278523 8/22 (36%)
C2H2 Zn finger 217..237 CDD:275368 8/20 (40%)
zf-H2C2_2 229..254 CDD:290200 12/25 (48%)
C2H2 Zn finger 245..265 CDD:275368 7/20 (35%)
zf-H2C2_2 257..282 CDD:290200 10/25 (40%)
C2H2 Zn finger 273..293 CDD:275368 5/20 (25%)
zf-H2C2_2 286..310 CDD:290200 8/24 (33%)
C2H2 Zn finger 301..321 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.