DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pita and CG10147

Sequence 1:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_001261477.1 Gene:CG10147 FlyBaseID:FBgn0035702 Length:448 Species:Drosophila melanogaster

Alignment Length:514 Identity:107/515 (21%)
Similarity:171/515 (33%) Gaps:150/515 (29%)


  Fly    59 DGMPGHICLECRLLFEHCYRFKQMCKRAETLLRQYPLTGNWPSPLEKPRAPMTMVASKKLLVVPA 123
            |.:|..||.||..|.|..:.|:.:|..|:...|                       ||.|:    
  Fly    47 DILPSEICSECYELLEKFHSFRALCIIADNKWR-----------------------SKSLV---- 84

  Fly   124 KTAEPSETPKKLLNTMAKSSSQVIIEDVQVLESAMVTPRTVAGSSPVPRRSHAYELKVDNNQELS 188
                   |.||                                   :.||...||:..|..:||.
  Fly    85 -------TWKK-----------------------------------IDRRKPVYEVDEDEEEELE 107

  Fly   189 MDDVQSMLEDMASELEKEFPDIPQKASPVKPKVLNKSSIRILNKGPAAPVEPRLATPKVKRDDSG 253
            ::           ||..|.|::          ::..:::...|            ||        
  Fly   108 LE-----------ELLLEPPEM----------IICDTNLSAQN------------TP-------- 131

  Fly   254 NVAIVTEVLDSDLPLDDQDDPTKNAEKVATDVFPCPDCERSFPLQQLLEIHRLNHTRSRSFQCLL 318
               ||.|          |..||........:|...|:.|:.          .|......:::|.|
  Fly   132 ---IVAE----------QAPPTLVFHTFTENVQQPPETEKK----------ALEEPPLTTYKCDL 173

  Fly   319 CEKSFFSKYDLAKHNFVHTGERPFKCAI--CSKAFTRKALLHRHERTHTDV-PKFICVY--CEKP 378
            |...|..:..|..|...|.|...:.|..  |.:||.|...|.:||..|::| .:|:|..  |.:.
  Fly   174 CADEFREEKRLILHKKEHQGHMLYHCTEPGCEEAFNRFENLRQHELEHSEVGMRFVCEEEGCNRM 238

  Fly   379 FLSRQEMEKH-AERHQKKRPFQ---CGVCTKSFAFKQGLERHETVHSTN--LPFPCQ--HCERSF 435
            :..:..::.| ::.|...:|.:   |..|.:.|.....|.:|...|...  ||:.|:  .|...|
  Fly   239 YRHKASLKYHQSKAHDIGKPLKTHMCEFCGRVFKTGSALSQHRFTHGDQLVLPYACELPECSMRF 303

  Fly   436 STASKLARHLVAHAGKRAYPCKYCHKSYMLSHHLSRHLRTHTQTSDASFVCSECKVSYSNYNDLL 500
            .:..||..|::.|.|.:.:.|.||.......:.|..|:..|  |.:.::.|.:|....::...|.
  Fly   304 YSTEKLKIHMMRHQGIKNFSCPYCGLKKTTKNELRLHINYH--TLERTWSCKDCPKVCNSSTSLK 366

  Fly   501 DH-ALIHATA-SLKCPMCRKQIEDIDSVESHMDQHKQSERHACEFCDHIFLTQKCLQRH 557
            .| ..||..| ...|..|.|:....|:.:.|...|...:...|..|...|:....|:.|
  Fly   367 KHIRAIHEKARDYACSYCEKKFATTDTRKYHEMTHTGEKNFECHVCGKKFIQPSALRTH 425

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871 12/33 (36%)
COG5048 <281..506 CDD:227381 56/239 (23%)
C2H2 Zn finger 288..308 CDD:275368 3/20 (15%)
C2H2 Zn finger 316..336 CDD:275368 6/20 (30%)
zf-H2C2_2 328..353 CDD:290200 8/27 (30%)
C2H2 Zn finger 344..364 CDD:275368 8/22 (36%)
C2H2 Zn finger 372..388 CDD:275370 2/18 (11%)
C2H2 Zn finger 400..420 CDD:275368 5/20 (25%)
C2H2 Zn finger 428..448 CDD:275368 6/22 (27%)
C2H2 Zn finger 456..476 CDD:275368 5/20 (25%)
C2H2 Zn finger 486..506 CDD:275368 5/21 (24%)
HARE-HTH <566..625 CDD:294801
CG10147NP_001261477.1 zf-AD 7..80 CDD:214871 12/56 (21%)
C2H2 Zn finger 171..191 CDD:275368 6/20 (30%)
zf-C2H2_8 199..287 CDD:292531 22/88 (25%)
C2H2 Zn finger 199..221 CDD:275368 8/22 (36%)
C2H2 Zn finger 230..253 CDD:275368 3/23 (13%)
C2H2 Zn finger 264..284 CDD:275368 5/20 (25%)
C2H2 Zn finger 294..316 CDD:275368 6/22 (27%)
C2H2 Zn finger 324..344 CDD:275368 5/20 (25%)
C2H2 Zn finger 352..373 CDD:275368 5/21 (24%)
C2H2 Zn finger 381..401 CDD:275368 5/20 (25%)
C2H2 Zn finger 409..429 CDD:275368 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.