DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pita and Kr

Sequence 1:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_001261181.1 Gene:Kr FlyBaseID:FBgn0001325 Length:502 Species:Drosophila melanogaster

Alignment Length:585 Identity:126/586 (22%)
Similarity:198/586 (34%) Gaps:208/586 (35%)


  Fly   129 SETPKKLLNTMAKSSSQVIIEDVQVLESAMVTPRTVAGS-----SPVPRRSHAYELKVDNNQELS 188
            |.:|....||.|.|::.:.        .||...:..|.|     ||.       :|...|.|..:
  Fly    33 SLSPPMSANTSATSAAAIY--------PAMGLQQAAAASAFGMLSPT-------QLLAANRQAAA 82

  Fly   189 MDDVQSMLEDMASELEKEFPDIP---------QKASPVKPKVLNKSSIRILNKGPAAPVEPRLAT 244
            . ..|..:..:|:.|   ||..|         |::.|  |:..:      |:..||:|..| |:|
  Fly    83 F-MAQLPMSTLANTL---FPHNPAALFGAWAAQQSLP--PQGTH------LHSPPASPHSP-LST 134

  Fly   245 PKVKRDDSGNVAIVTEVLDSDLPLDDQDDPTKNAEKVATDVFPCPDCERSFPLQQLLEIHRLNHT 309
            |.    .||.     ..|:|........:|.|.|.|::.        ::.|..:..:.::.:.||
  Fly   135 PL----GSGK-----HPLNSPNSTPQHHEPAKKARKLSV--------KKEFQTEISMSVNDMYHT 182

  Fly   310 -----------------------------------RSRSFQCLLCEKSFFSKYDLAKHNFVHTGE 339
                                               |.:||.|.:|.:||..|:.|..|...||||
  Fly   183 SGGPISPPSSGSSPNSTHDGAGGNAGCVGVSKDPSRDKSFTCKICSRSFGYKHVLQNHERTHTGE 247

  Fly   340 RPFKCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEKHAERHQKKRPFQCGVCT 404
            :||:|..|.|.|||...|..|.|.||.                            ::|:.|..|.
  Fly   248 KPFECPECHKRFTRDHHLKTHMRLHTG----------------------------EKPYHCSHCD 284

  Fly   405 KSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKLARHLVAHAGKRAYPCKYCHKSYMLSHHL 469
            :.|.....|.||..||:...|:.|:.|:..||.:::|..|::.|.|::.:.|:.||..:...|||
  Fly   285 RQFVQVANLRRHLRVHTGERPYTCEICDGKFSDSNQLKSHMLVHNGEKPFECERCHMKFRRRHHL 349

  Fly   470 SRH--------------------------LRTHTQTSDASFVCSECKVSYSNYNDLLDHALIHAT 508
            ..|                          :.....|:..:.:|:    :|...|:.:|  :..||
  Fly   350 MNHKCGIQSPPTPALSPAMSGDYPVAISAIAIEASTNRFAAMCA----TYGGSNESVD--MEKAT 408

  Fly   509 ASLKCPMCRKQIEDIDSVESHMDQHKQSERHACEFCDHIFLTQKCLQRHIED------------D 561
            .....|:...: :...||:.|              |.:|      .:|..:|            .
  Fly   409 PEDDGPLDLSE-DGASSVDGH--------------CSNI------ARRKAQDIRRVFRLPPPQIP 452

  Fly   562 HVVEMEPYQNEFEDDGEGEGGVDEKEEHLDDFEDMDNVKQEEFVTEYLEDDALYEDHLDDSDESF 626
            ||....|.|.|.||............|..||.:                   ||:  |||:..|:
  Fly   453 HVPSDMPEQTEPEDLSMHSPRSIGSHEQTDDID-------------------LYD--LDDAPASY 496

  Fly   627  626
              Fly   497  496

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871
COG5048 <281..506 CDD:227381 60/286 (21%)
C2H2 Zn finger 288..308 CDD:275368 1/20 (5%)
C2H2 Zn finger 316..336 CDD:275368 7/20 (35%)
zf-H2C2_2 328..353 CDD:290200 13/25 (52%)
C2H2 Zn finger 344..364 CDD:275368 9/20 (45%)
C2H2 Zn finger 372..388 CDD:275370 0/16 (0%)
C2H2 Zn finger 400..420 CDD:275368 7/20 (35%)
C2H2 Zn finger 428..448 CDD:275368 6/20 (30%)
C2H2 Zn finger 456..476 CDD:275368 7/46 (15%)
C2H2 Zn finger 486..506 CDD:275368 4/20 (20%)
HARE-HTH <566..625 CDD:294801 13/59 (22%)
KrNP_001261181.1 C2H2 Zn finger 224..244 CDD:275368 7/20 (35%)
zf-H2C2_2 237..261 CDD:290200 13/24 (54%)
C2H2 Zn finger 252..272 CDD:275368 9/20 (45%)
zf-H2C2_2 264..289 CDD:290200 9/53 (17%)
C2H2 Zn finger 280..300 CDD:275368 7/20 (35%)
zf-H2C2_2 292..316 CDD:290200 9/24 (38%)
C2H2 Zn finger 308..328 CDD:275368 6/20 (30%)
zf-H2C2_2 321..345 CDD:290200 7/24 (29%)
C2H2 Zn finger 336..352 CDD:275368 6/16 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.