DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pita and CG31441

Sequence 1:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_731558.1 Gene:CG31441 FlyBaseID:FBgn0051441 Length:341 Species:Drosophila melanogaster

Alignment Length:482 Identity:91/483 (19%)
Similarity:178/483 (37%) Gaps:161/483 (33%)


  Fly    15 KRVCRFC---LT--EQKLASIFEENPRVKTTANLPLQIMAITAIEVYAGDGMPGHICLECRLLFE 74
            :.:||.|   :|  :.:...:|.     |:..:....:..||.:.:.....:|..||..|::..:
  Fly     5 RSICRTCGKNVTNLQGRATKLFN-----KSNYHFISILENITDMYLEFDTTLPHLICQCCKVQLD 64

  Fly    75 HCYRFKQMCKRAETLLRQYPLTGNWPSPLEKPRAPMTMVASKKLLVVPAKTAEPSETPKKLLNTM 139
            ....|:..|                   ||..::  .|.|::|||...|...|..:.|       
  Fly    65 RILTFRNKC-------------------LEVHKS--FMAANRKLLRKKAIVDEELDKP------- 101

  Fly   140 AKSSSQVIIEDVQVLESAMVTPRTVAGSSPVPRRSHAYELKVDNNQEL--SMDDVQSMLEDMASE 202
                      ||:.|:.                     :|....:||:  :|.|...:|.:..::
  Fly   102 ----------DVEKLQQ---------------------DLWDHTDQEMCVAMADTAGLLREDHND 135

  Fly   203 LE--KEFPDIPQKASPVKPKVLNKSSIRILNKGPAAPVEPRLATPKVK--RDDSGNVAIVTEVLD 263
            .|  |:..|..|.....:.:|                   ::.|.:|:  ::...|::|:::.:.
  Fly   136 NEKAKDAEDATQNEKNQEEQV-------------------QVQTEEVEHCQEQLHNMSIISKGVS 181

  Fly   264 SDLPLDDQDDPTKNAEKVATDVFPCPDCERSFPLQQLLEIHRLNHTRSRSFQCLLCEKSFFSKYD 328
            :.:|        |..::.:...| |..|...|.....|::|...|:..:.|.|.:|:..:::..:
  Fly   182 ARVP--------KRTKRNSKSWF-CDQCGGVFKSSTYLKLHLQRHSGHKPFACDICQAKYYTDNE 237

  Fly   329 LAKHNFVHTGERPFKCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEKHAERHQ 393
            :.:|..:||..||:.|..|||.:...:....||||||:                           
  Fly   238 MRRHRILHTDARPYACRFCSKTYRGCSSKVVHERTHTN--------------------------- 275

  Fly   394 KKRPFQCGVCTKSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKLARHLVAHAGKRAYPCKY 458
             :||||                            ||||:::|::.|...:|.:.|..:|.|.|:.
  Fly   276 -ERPFQ----------------------------CQHCDKAFTSTSTRQKHEMLHTNQRKYHCEI 311

  Fly   459 CHKSYMLSHHLSRHLRT--HTQTSDAS 483
            |.:.::.|.||:.|..|  |.:.::::
  Fly   312 CDQWFLRSSHLTLHQSTKLHQRRAESA 338

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871 14/80 (18%)
COG5048 <281..506 CDD:227381 47/206 (23%)
C2H2 Zn finger 288..308 CDD:275368 5/20 (25%)
C2H2 Zn finger 316..336 CDD:275368 3/20 (15%)
zf-H2C2_2 328..353 CDD:290200 9/25 (36%)
C2H2 Zn finger 344..364 CDD:275368 8/20 (40%)
C2H2 Zn finger 372..388 CDD:275370 0/16 (0%)
C2H2 Zn finger 400..420 CDD:275368 0/20 (0%)
C2H2 Zn finger 428..448 CDD:275368 7/20 (35%)
C2H2 Zn finger 456..476 CDD:275368 7/22 (32%)
C2H2 Zn finger 486..506 CDD:275368
HARE-HTH <566..625 CDD:294801
CG31441NP_731558.1 zf-AD 7..82 CDD:285071 17/101 (17%)
COG5048 <174..337 CDD:227381 50/228 (22%)
C2H2 Zn finger 197..217 CDD:275370 5/20 (25%)
C2H2 Zn finger 225..245 CDD:275368 3/20 (15%)
C2H2 Zn finger 253..273 CDD:275368 8/20 (40%)
zf-H2C2_2 268..290 CDD:290200 15/78 (19%)
C2H2 Zn finger 281..301 CDD:275368 7/20 (35%)
C2H2 Zn finger 309..328 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2463
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
22.150

Return to query results.
Submit another query.