DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pita and CG18262

Sequence 1:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_572453.1 Gene:CG18262 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster

Alignment Length:364 Identity:86/365 (24%)
Similarity:148/365 (41%) Gaps:95/365 (26%)


  Fly   179 LKVDNNQELSMDDVQSMLEDMASELEKEFPDIP--------QKASPVKPKVLNKSSIRILNKGPA 235
            ::|..|:||.    :.:.::.:.:||:|..:..        |:|:.:|..:              
  Fly    77 VEVQGNEELH----EELAKEASPDLEEEEEEKEEGSKRQHYQRAAAMKNTL-------------- 123

  Fly   236 APVEPRLATPKVKRDDSG------NVAIVTEVLDSDLPLDDQDDPTKNAEKVATDVFPCPDCERS 294
              ||.|.....::.|.:|      |.....|..:||      ||.||::......:|.|..|:|:
  Fly   124 --VETREDLLDIELDWTGGEQSEHNETHEEEEGESD------DDDTKDSNDTKDMLFQCDQCDRA 180

  Fly   295 FPLQQLLEIH-RLNHTRS---------------------RSFQC--LLCEKSFFSKYDLAKHNFV 335
            :..::.|:.| ||.|:.:                     :.::|  ..|.::|.::.||..|.:.
  Fly   181 YNTKRSLQSHRRLKHSEANGGSLDKSASERNSKKRKGPPKVYKCNEEACNQTFRTERDLRGHRWK 245

  Fly   336 HTGERPFKCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEMEKHA----------- 389
            |||   ..|.||.|.||:...:.||.:.|:.:....|..|:..|.:::|:..|:           
  Fly   246 HTG---IFCDICGKPFTQSGNMMRHRQRHSGIKPHKCPECDATFYTQKELSSHSICHTGRMPCIC 307

  Fly   390 -----------------ERHQKKRPFQCGVCTKSFAFKQGLERHETVHSTNLPFPCQHCERSFST 437
                             .||..:||.:|.||.|:|.....|..|...|:...||.|..|..:|..
  Fly   308 EVCGRPCRDRGVLTAHMRRHTGERPAKCEVCGKAFYSFHDLNVHAVSHTNLRPFVCDVCGSTFQR 372

  Fly   438 ASKLARHLVAHAGKRAYPCKYCHKSYMLSHHLSRHLRTH 476
            ...|..|.:.|:.:|.|.||.|.|::..|..|:.|:|:|
  Fly   373 KKALRVHKLLHSEQRKYACKLCGKTFAQSGGLNAHMRSH 411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871
COG5048 <281..506 CDD:227381 63/249 (25%)
C2H2 Zn finger 288..308 CDD:275368 7/21 (33%)
C2H2 Zn finger 316..336 CDD:275368 6/22 (27%)
zf-H2C2_2 328..353 CDD:290200 12/25 (48%)
C2H2 Zn finger 344..364 CDD:275368 8/20 (40%)
C2H2 Zn finger 372..388 CDD:275370 4/16 (25%)
C2H2 Zn finger 400..420 CDD:275368 7/20 (35%)
C2H2 Zn finger 428..448 CDD:275368 5/20 (25%)
C2H2 Zn finger 456..476 CDD:275368 8/20 (40%)
C2H2 Zn finger 486..506 CDD:275368
HARE-HTH <566..625 CDD:294801
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 6/22 (27%)
C2H2 Zn finger 251..271 CDD:275368 8/20 (40%)
COG5048 <256..415 CDD:227381 42/157 (27%)
zf-H2C2_2 263..288 CDD:290200 6/25 (24%)
C2H2 Zn finger 279..327 CDD:275368 6/48 (13%)
zf-H2C2_2 320..342 CDD:290200 8/22 (36%)
C2H2 Zn finger 335..355 CDD:275368 7/20 (35%)
C2H2 Zn finger 363..383 CDD:275368 5/20 (25%)
zf-C2H2 389..411 CDD:278523 9/22 (41%)
C2H2 Zn finger 391..411 CDD:275368 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C313263890
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.