DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pita and Y55F3AM.14

Sequence 1:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster
Sequence 2:NP_500033.1 Gene:Y55F3AM.14 WormBaseID:WBGene00021931 Length:662 Species:Caenorhabditis elegans

Alignment Length:534 Identity:132/535 (25%)
Similarity:219/535 (41%) Gaps:89/535 (17%)


  Fly   161 PRTVAGSSPVPRRSHAYELKVDNNQELSMDDVQSMLEDMASELEKEFPDIPQKASPVKPKVLNKS 225
            |.|.  ::.:|...|..:.:.:..:|.. |::....|:...||| |..:....:|.|.....:.|
 Worm     8 PTTT--NTTLPDDIHMKDPEEEEFEEYE-DELLEEEEEFDEELE-ELENSDSASSLVSAGSPHGS 68

  Fly   226 SIRILNKGPAAPVEPRLATPKVKRDDSGNVAIVTEVLDSDLPLDDQDDPTKNAEKVATDVFPCPD 290
            |....:.|.:.|::  :.:|......||:                   ||...||...    |..
 Worm    69 SSSNGSHGSSPPLQ--VQSPSQGSGSSGS-------------------PTGQPEKRHI----CTV 108

  Fly   291 CERSFPLQQLLEIHRLNHTRSRSFQCLLCEKSFFSKYDLAKHNFVHTGERPFKCAICSKAFTRKA 355
            |.:.|....:||.|:.:||..:.:.|..|:|:|..|..|..|...||||||:||..|.|.|.:..
 Worm   109 CGKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYG 173

  Fly   356 LLHRHERT-HTDVPKFICVYCEKPFLSRQEMEKHAERHQKKRPFQCGVCTKSFAFKQGLERH-ET 418
            ....||:: |..:..:.|..|:|...|...:..|.:.|..| .|:|..|.|:||.|..|:.| :.
 Worm   174 TKTVHEKSAHLGIRNYKCPKCDKLLSSPSALYTHKKTHGDK-TFRCDFCPKTFALKNYLKLHVKQ 237

  Fly   419 VHSTN-LPFPCQHCERSFSTASKLARHLVAHAGKRAYPCKYCHKSYMLSHHLSRHLRTHTQTSDA 482
            ||..| ....|.:|.:.|:.|..|..|:..|.|:|.|.||:|.|::....:|..|.|||  |.:.
 Worm   238 VHEQNERKHVCVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTH--TGER 300

  Fly   483 SFVCSECKVSYSNYNDLLDHALIHAT---------------------------ASLKCPMCRKQI 520
            .:.|..|:.::...:.|..|...|.|                           .:.:|..|.|:.
 Worm   301 PYSCQFCQRTFIQKSQLTAHESTHLTQKHSVNPDSTTADILPVAGSVTDHQMVGNYECTFCNKKY 365

  Fly   521 EDIDSVESHMDQHKQSERHACEFCDHIFLTQKCLQRHIEDDHVVEMEPYQNEFED---------D 576
            ....|:..||.:|.:...::|:.|...: :|| :..:|..|   :.|.::|..:.         |
 Worm   366 PYASSLYIHMRKHTEKSAYSCDGCGKPY-SQK-ISLNIHQD---QCEAFKNRLKTTDSQFSHNCD 425

  Fly   577 GEGEGGVDE--KEEHLDDFEDMDNVKQEEFVTEYLEDDALYEDHLDDSDESFTP---PP----PK 632
            |.|:..|..  .:.|:|..|...|:.:.:...:  ::.....|...|::....|   ||    |.
 Worm   426 GCGKSFVQRIALQIHVDSCEPHKNLARLKLSQQ--QNQNQNSDSESDTEMKICPLPNPPLTLAPT 488

  Fly   633 QRKTNPPKD--AQQ 644
            .::..||.:  |||
 Worm   489 HQQIPPPVNIYAQQ 502

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pitaNP_611806.3 zf-AD 17..92 CDD:214871
COG5048 <281..506 CDD:227381 72/228 (32%)
C2H2 Zn finger 288..308 CDD:275368 6/20 (30%)
C2H2 Zn finger 316..336 CDD:275368 7/20 (35%)
zf-H2C2_2 328..353 CDD:290200 13/25 (52%)
C2H2 Zn finger 344..364 CDD:275368 6/21 (29%)
C2H2 Zn finger 372..388 CDD:275370 4/16 (25%)
C2H2 Zn finger 400..420 CDD:275368 9/21 (43%)
C2H2 Zn finger 428..448 CDD:275368 6/20 (30%)
C2H2 Zn finger 456..476 CDD:275368 8/20 (40%)
C2H2 Zn finger 486..506 CDD:275368 4/20 (20%)
HARE-HTH <566..625 CDD:294801 12/70 (17%)
Y55F3AM.14NP_500033.1 C2H2 Zn finger 106..126 CDD:275368 6/20 (30%)
zf-H2C2_2 119..143 CDD:290200 9/24 (38%)
C2H2 Zn finger 134..154 CDD:275368 7/20 (35%)
zf-H2C2_2 147..171 CDD:290200 13/24 (54%)
C2H2 Zn finger 162..180 CDD:275368 6/18 (33%)
COG5048 <187..404 CDD:227381 57/222 (26%)
C2H2 Zn finger 191..211 CDD:275370 5/20 (25%)
C2H2 Zn finger 218..239 CDD:275368 9/21 (43%)
C2H2 Zn finger 248..268 CDD:275368 6/20 (30%)
zf-H2C2_2 260..285 CDD:290200 10/25 (40%)
C2H2 Zn finger 276..296 CDD:275368 8/20 (40%)
zf-H2C2_2 288..313 CDD:290200 8/27 (30%)
C2H2 Zn finger 304..324 CDD:275368 4/20 (20%)
C2H2 Zn finger 386..403 CDD:275368 5/19 (26%)
C2H2 Zn finger 424..441 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.925 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.