DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and AgaP_AGAP011023

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_001688207.1 Gene:AgaP_AGAP011023 / 5668032 VectorBaseID:AGAP011023 Length:172 Species:Anopheles gambiae


Alignment Length:139 Identity:25/139 - (17%)
Similarity:56/139 - (40%) Gaps:18/139 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KKIECLVNRTRVSNVSCHVK--------AINWNLAVVNMDCFMIVPLHNPIIRMQVFTKDYSNQY 83
            |::| |.|..|..|:|...:        :|::::.|..       .:.:..:.:..::...:|..
Mosquito     6 KRLE-LKNNARSVNISYTFRNPKRFLEQSIDFDVDVQR-------EIRDMKLSLAYYSVSRNNGT 62

  Fly    84 KPFLVDVKIRICEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFS-GHLIARDGFLDTSLLPPF-P 146
            :..|:...:.:|..:...|.......:::|.|.:..:...|||. |....||.......:|.| |
Mosquito    63 QTALLKRHVDLCFFLRNPNSDRLVNRVYQLVKAHGTMPTKCPFGPGCFYMRDMKPSEIPIPLFLP 127

  Fly   147 QGFYQVSLV 155
            :..:.:.|:
Mosquito   128 EAEFVLELI 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 15/83 (18%)
AgaP_AGAP011023XP_001688207.1 DUF1091 54..133 CDD:284008 15/78 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20898
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.