DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and AgaP_AGAP011018

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_001688212.1 Gene:AgaP_AGAP011018 / 5667965 VectorBaseID:AGAP011018 Length:159 Species:Anopheles gambiae


Alignment Length:128 Identity:24/128 - (18%)
Similarity:56/128 - (43%) Gaps:9/128 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RTRVSNVSC-HVKAINWNLAVVNMDCFMIVPLHNPIIRMQVFTKDY----SNQYKPFLVDVKIRI 94
            |::|.:::. |......:|...::|  |.:.:.:|:..|:::...|    ::..:..||...:.:
Mosquito     8 RSKVKHINASHQFCRRDSLTEQSLD--MKLDITSPLREMKLYFSYYPILGNSTARTALVKRTVDL 70

  Fly    95 CEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFS-GHLIARDGFLDTSLLPPF-PQGFYQVSLV 155
            |..|:..|......|::...:..:|:...||.. |....|:.......:|.| |:..:.:.|:
Mosquito    71 CFYIQHPNSDRLLRIVYDYVRERSNLPERCPVEPGSYYIRNAKPSDVPVPAFIPESEFMLELI 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 16/87 (18%)
AgaP_AGAP011018XP_001688212.1 DUF1091 63..130 CDD:284008 14/66 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 43 1.000 Domainoid score I19524
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20898
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.