DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and AgaP_AGAP011006

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_001688224.1 Gene:AgaP_AGAP011006 / 5667817 VectorBaseID:AGAP011006 Length:208 Species:Anopheles gambiae


Alignment Length:198 Identity:43/198 - (21%)
Similarity:73/198 - (36%) Gaps:71/198 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVVLLGCCFIGQLTNTQLVYKLKKIECLVNRTRVSNVSCHVKAINWNLAVVNMDCF----MIVPL 65
            |:|||     ..|:.|:.. |.:::..|.|   ::|:..|.|        :..|||    |::.|
Mosquito     7 LLVLL-----AYLSGTEAA-KPERVSLLYN---LANILVHFK--------IPFDCFASLQMLIML 54

  Fly    66 HNPIIRMQVFTKDYSN------QY--KPF--------------------------------LVDV 90
            .|..:   ..|..|.|      :|  .||                                |.:.
Mosquito    55 TNADV---TATTRYLNASVTLTRYPTAPFSTFDLVVNFLEKLNTLTLQSRYSVRTGMMENVLYES 116

  Fly    91 KIRICEVIERRN--FIPYGVIMWKLFKRYTNVNHSCPFSG-HLIARDGFLDTSLLPPF-PQGFYQ 151
            .|.:|..:.|.|  |:.   :::...||:..|..|||... .|..|:..|:...||.: ||..::
Mosquito   117 TIDLCAFLHRPNERFVK---MVFDSLKRHGRVLTSCPVQPLQLHFRNTTLNHVRLPVYLPQTNFK 178

  Fly   152 VSL 154
            :::
Mosquito   179 LAV 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 25/125 (20%)
AgaP_AGAP011006XP_001688224.1 DUF1091 113..179 CDD:284008 19/68 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20898
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.