DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG13250

DIOPT Version :8

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster

Alignment Length:162 Identity:32/163 (20%)
Similarity:62/163 (38%) Gaps:58/163 (36%)


  Fly    59 CFMIVPLHNPIIRMQVFTKDYSNQYKPF---LVD---VKIRICEVIE----RRNFIPYGVI---- 109
            |.::||:   :.:..:.|:|:..:::..   ::|   .:|..|:::|    :.||:...::    
  Fly    14 CCLVVPI---LWQPSLATRDFDIRWRDINCSVIDPTTAEIFKCDIVEMPKKQGNFLNTFLLLRRS 75

  Fly   110 ---MW-----------------KLFKRYTNVNHSCPFSGHLI---ARDGFLDTSLLPPFPQGFY- 150
               ||                 :|||...:   .|    |||   ::...|:..|......|.| 
  Fly    76 VTKMWVELSVGQIANRKDRPVQQLFKIRVD---GC----HLIEFRSKSRILNAVLHKLLQSGNYP 133

  Fly   151 QVSLVVTDTNSTST----------DYVGTMKF 172
            ....::.:.|.|||          .|:..|||
  Fly   134 DACPLLANVNYTSTRFALNPDHFPAYMPDMKF 165

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 21/120 (18%)
CG13250NP_649245.1 DM8 95..181 CDD:214778 19/79 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C300143
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.