DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33757

DIOPT Version :8

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027398.1 Gene:CG33757 / 3772602 FlyBaseID:FBgn0053757 Length:178 Species:Drosophila melanogaster

Alignment Length:166 Identity:46/167 (28%)
Similarity:81/167 (49%) Gaps:22/167 (13%)


  Fly    17 LTNTQLVYKLKKIECL-VNRTRVSNVSCHVKAINWNLAVVNMDCFMIVPLHNPIIRMQVFTKDYS 80
            ||..||..|.|.:.|. .:|:....:.|.:||||.....:::....:..::|..:|:::|.:  :
  Fly    13 LTPLQLEAKFKSLHCTNYDRSYGEILLCKIKAINRYRNSISIQFRQLRTVNNVHMRLELFKR--A 75

  Fly    81 NQYKPFLVDVKIRICEVIERRNFIPYGVIM---WKLFKRYTNV-NHSCPF-SGHLI-ARDGFLDT 139
            |.::|||.::...:|:.:.:||    .||:   ::..|.|..: |::||| ..||| ..|...|.
  Fly    76 NGWRPFLYNISFNLCDFLSKRN----NVIVSLGYEYLKPYIPMTNYTCPFKKNHLIKCTDLEFDI 136

  Fly   140 SLLP---PFPQGFY--QVSLV----VTDTNSTSTDY 166
            ....   |...|.|  |:|.:    ||.|.:.|.:|
  Fly   137 EKFRVRFPIETGEYALQLSFIVQRKVTLTLNGSAEY 172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 26/93 (28%)
CG33757NP_001027398.1 DUF1091 67..152 CDD:284008 25/91 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.