DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33725

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster


Alignment Length:159 Identity:53/159 - (33%)
Similarity:92/159 - (57%) Gaps:10/159 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLVLVVLLGCCFIGQLT---NTQLVYKLKKIECLV-NRTRVSNVSCHVKAINWNLAVVNMDCFMI 62
            |||..:|  |..:|.|.   |..:|:|.....||. |::.....:|.:||::....::|.:..::
  Fly     4 KLVTSIL--CVAVGILVIDLNDAVVFKFTNFACLSRNQSWFVFHNCRLKAVSREKVLLNFNGTVL 66

  Fly    63 VPLHNPIIRMQVFTKDYSNQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFS 127
            .|.:|.|:.:::|.|  :|.:||:|:|||:..|..: |.||.|:..|::.|||.::.:||:||:.
  Fly    67 HPANNIIVHVKLFKK--ANGFKPWLLDVKLDACRFV-RTNFHPFVRIIFDLFKDFSTINHTCPYV 128

  Fly   128 GHLIARDGFLDTSLLP-PFPQGFYQVSLV 155
            |..:.:|.:|....|. |||.|.|.:||:
  Fly   129 GLQVVKDFYLRPEKLKLPFPSGDYLLSLI 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 31/82 (38%)
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 31/82 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471955
Domainoid 1 1.000 43 1.000 Domainoid score I19524
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.940

Return to query results.
Submit another query.