DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33658

DIOPT Version :8

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster

Alignment Length:148 Identity:42/149 (28%)
Similarity:61/149 (41%) Gaps:31/149 (21%)


  Fly    16 QLTN---TQLVYKLKKIE-CL---VNRTRVSNVSCHVKAIN-WNLAVVNMDCFMIVPLHNPIIRM 72
            :.||   |.:...:..|| |.   |||| ...:|..:|.:. .|...||..      ||..|   
  Fly    29 EFTNFKCTSMAKDVADIEYCFLKSVNRT-YQYLSTRIKVLKLLNSLKVNFG------LHQQI--- 83

  Fly    73 QVFTKDYSNQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFSGHLIARDGFL 137
                    |.|||||.::.|..|:.::...........:...:..:|:|||||::..:|......
  Fly    84 --------NGYKPFLYNITIDGCQFMKNTKSNVVAKYFYDFIRNISNLNHSCPYNHDIIMEKLTS 140

  Fly   138 DT--SLLP---PFPQGFY 150
            :|  |.||   |||.|.|
  Fly   141 ETINSRLPKTLPFPTGNY 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 24/87 (28%)
CG33658NP_001027209.1 DUF1091 84..160 CDD:284008 24/76 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C293739
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.