DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33630

DIOPT Version :8

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027166.1 Gene:CG33630 / 3772504 FlyBaseID:FBgn0053630 Length:212 Species:Drosophila melanogaster

Alignment Length:116 Identity:30/117 (26%)
Similarity:49/117 (42%) Gaps:26/117 (22%)


  Fly    69 IIRMQVFTK-DYSNQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFSGHLIA 132
            |:.::|..| :.||.:.......:|..||.:...|..|   :|..:||:  ||.           
  Fly    81 IMNIKVRVKPEGSNAFVQLFELRRINFCEFLSEYNTNP---MMEMMFKK--NVK----------- 129

  Fly   133 RDGFLDTSLLPPFPQGFYQVSLVVTD-TNSTSTDYV--GTMKFFLQAMEHI 180
                |:..::.|...|.|  ||:.:| ..:...|.|  ||.:||.:.:|.|
  Fly   130 ----LNDIIVCPVRVGNY--SLLNSDIAENIHADGVQNGTYRFFAEIVEEI 174

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 18/83 (22%)
CG33630NP_001027166.1 DM8 96..186 CDD:214778 25/102 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C48131
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.