powered by:
Protein Alignment CG33919 and CG33723
DIOPT Version :9
| Sequence 1: | NP_001027393.1 |
Gene: | CG33919 / 3772720 |
FlyBaseID: | FBgn0053919 |
Length: | 191 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001027235.1 |
Gene: | CG33723 / 3772451 |
FlyBaseID: | FBgn0053723 |
Length: | 180 |
Species: | Drosophila melanogaster |
| Alignment Length: | 189 |
Identity: | 48/189 - (25%) |
| Similarity: | 84/189 - (44%) |
Gaps: | 32/189 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2 KLVLVVLLGCCFIGQLTNTQLVYKLK------KIEC-LVNRTRVSNVSCHVKAINWNLAVVNMDC 59
||.|:|.| |....:|.::| .::| .||:.......|.:|:||.....::..
Fly 5 KLTLLVSL-------LLLMLIVKEIKPRVEFTNLKCRSVNKDFAEFTQCTLKSINRTYKYISTK- 61
Fly 60 FMIVPLHN-PIIRMQVFTKDYS--NQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKRYTNVN 121
|.||. ||.:.:|....|. |.|:|||.:..:..|...:.:...|.....:.:.|.|:|:|
Fly 62 ---VSLHKLPITKARVNFGLYKRFNGYRPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEYSNLN 123
Fly 122 HSCPFSGHLIARDGFLDT-----SLLPPFPQGFYQVSLVVTDTNSTSTD-YVGTMKFFL 174
||||::..:|......|| :.:.|:|:|.|.: :|:....| |.|.::.::
Fly 124 HSCPYNNDIIVEKVSTDTVNHHVTKILPYPEGDYML-----ETHWMLNDIYCGVIQVYI 177
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
1 |
0.930 |
- |
- |
|
C45472597 |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
1 |
1.000 |
- |
- |
|
X90 |
|
4 | 3.940 |
|
Return to query results.
Submit another query.