DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33766

DIOPT Version :8

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster

Alignment Length:195 Identity:40/196 (20%)
Similarity:73/196 (37%) Gaps:51/196 (26%)


  Fly     2 KLVLVVLLG--CCFIGQLTNTQLVYKLKKIEC-LVNRTRVSNVSCHVKAINWNLAV--------- 54
            |:||.:.:.  |..|..:...:::  |.:.:| ..||:..||.:..||....|:..         
  Fly     3 KVVLSISMSLICLIIVPIPTNKIL--LLESQCGNFNRSYFSNFTMFVKNSQMNMEFFLLRVLVPG 65

  Fly    55 VNMDCFMIVPLHNPIIRMQVFTKDYSNQYKPFLVDVKIRICEVI-ERRNFIPYGVIMWKLFKRY- 117
            |.||....:.:.|.....::|      ||       .:.:|.:: :|||         .:||:: 
  Fly    66 VTMDIEFFISMQNSYGFQKIF------QY-------TLDMCSLLAQRRN---------NMFKKWF 108

  Fly   118 ------TNVNHSCPFSGHLIARDGF-LDTSLLPPF-PQGFYQVSLVVTDTNSTSTDYVGTMKFFL 174
                  .|....||...:......: .:|..:|.| ..|.|:|..   |.|....  :..:::||
  Fly   109 ATFFDSGNFKKYCPVEPNFYYLKNYNYNTLFIPKFLYAGKYRVKF---DMNQLRK--IDGVRYFL 168

  Fly   175  174
              Fly   169  168

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 17/92 (18%)
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 20/105 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49047
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.