DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33772

DIOPT Version :10

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027146.4 Gene:CG33772 / 3772205 FlyBaseID:FBgn0053772 Length:185 Species:Drosophila melanogaster


Alignment Length:74 Identity:19/74 - (25%)
Similarity:32/74 - (43%) Gaps:13/74 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 ESQTFKKSFP----PLPIARII--VRRSSQRMLHFRELHRMYQQQEQTPVPLILMLVSDNL-SIH 366
            |.:.::||..    .||..|::  :.:..:..|.|:. |.:...||.....|:.:....|| :||
  Fly    51 EIRKYQKSTELLNRKLPFQRLVREIAQDFKTDLRFQS-HAVLALQEAAEAYLVGLFEDTNLCAIH 114

  Fly   367 CFLYDTKRV 375
                 .|||
  Fly   115 -----AKRV 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:461928
CG33772NP_001027146.4 DUF1091 89..182 CDD:472716 10/35 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.