DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33648

DIOPT Version :8

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027265.2 Gene:CG33648 / 3772188 FlyBaseID:FBgn0053648 Length:178 Species:Drosophila melanogaster

Alignment Length:162 Identity:43/162 - (26%)
Similarity:81/162 - (50%) Gaps:29/162 - (17%)


  Fly     3 LVLVVLLGCCFIGQLTNTQLVYKLKKIECLVNRTR-VSNVSCHVKAINWNLAVVNMDC-FMIVPL 65
            :::|:|.|       .|...:.:...|:|..:.|. |...||.:|::|.....::::. .:|:||
  Fly     9 MIVVILYG-------INDVSIVEFTNIKCSSSDTSYVYYESCRIKSVNRTYKYISVNSRLLILPL 66

  Fly    66 HNPIIRMQVFTKDYSNQYKPFLVDVKIRICEVI--ERRNFIP---YGVIMWKLFKRYTNV-NHSC 124
            .|..|.:.:: |.| |.|||||.:|.:..|..:  ::.|.:.   :.:|:.|     :|: :.:|
  Fly    67 TNATINVALY-KRY-NGYKPFLYNVSVDACRFLRTQKSNIVVKYLFDLILLK-----SNIRSPTC 124

  Fly   125 PFSGHLIARD----GFLDTSL--LPPFPQGFY 150
            ||:. .|:.|    .||:..|  :.|.|:|.|
  Fly   125 PFNS-FISVDKLTTNFLNNKLTQVLPVPEGDY 155

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 27/93 (29%)
CG33648NP_001027265.2 DUF1091 71..157 CDD:284008 27/93 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C290608
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.