powered by:
Protein Alignment CG33919 and CG33647
DIOPT Version :8
Sequence 1: | NP_001027393.1 |
Gene: | CG33919 / 3772720 |
FlyBaseID: | FBgn0053919 |
Length: | 191 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001027136.1 |
Gene: | CG33647 / 3772049 |
FlyBaseID: | FBgn0053647 |
Length: | 190 |
Species: | Drosophila melanogaster |
Alignment Length: | 47 |
Identity: | 16/47 - (34%) |
Similarity: | 26/47 - (55%) |
Gaps: | 4/47 - (8%) |
Fly 2 KLVLVV--LLGCCFIGQLTNTQLVYKLKKIECLVNRTR-VSNVSCHV 45
||.::| :||...:..:...:.|: :.|||||..... |.||||::
Fly 5 KLFILVDLILGTLILSSVRAEKEVF-MTKIECLNYMPELVRNVSCYL 50
|
Known Domains:
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33919 | NP_001027393.1 |
DUF1091 |
70..152 |
CDD:284008 |
|
CG33647 | NP_001027136.1 |
DUF1091 |
<95..156 |
CDD:284008 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
|
|
P |
PTHR20898 |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.