powered by:
Protein Alignment CG33919 and CG33647
DIOPT Version :9
| Sequence 1: | NP_001027393.1 |
Gene: | CG33919 / 3772720 |
FlyBaseID: | FBgn0053919 |
Length: | 191 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001027136.1 |
Gene: | CG33647 / 3772049 |
FlyBaseID: | FBgn0053647 |
Length: | 190 |
Species: | Drosophila melanogaster |
| Alignment Length: | 47 |
Identity: | 16/47 - (34%) |
| Similarity: | 26/47 - (55%) |
Gaps: | 4/47 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2 KLVLVV--LLGCCFIGQLTNTQLVYKLKKIECLVNRTR-VSNVSCHV 45
||.::| :||...:..:...:.|: :.|||||..... |.||||::
Fly 5 KLFILVDLILGTLILSSVRAEKEVF-MTKIECLNYMPELVRNVSCYL 50
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG33919 | NP_001027393.1 |
DUF1091 |
70..152 |
CDD:284008 |
|
| CG33647 | NP_001027136.1 |
DUF1091 |
<95..156 |
CDD:284008 |
|
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.
