DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33647

DIOPT Version :10

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027136.1 Gene:CG33647 / 3772049 FlyBaseID:FBgn0053647 Length:190 Species:Drosophila melanogaster


Alignment Length:47 Identity:16/47 - (34%)
Similarity:26/47 - (55%) Gaps:4/47 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLVLVV--LLGCCFIGQLTNTQLVYKLKKIECLVNRTR-VSNVSCHV 45
            ||.::|  :||...:..:...:.|: :.|||||..... |.||||::
  Fly     5 KLFILVDLILGTLILSSVRAEKEVF-MTKIECLNYMPELVRNVSCYL 50

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:461928
CG33647NP_001027136.1 DUF1091 <95..156 CDD:461928
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.