DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33767

DIOPT Version :8

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster

Alignment Length:185 Identity:45/186 (24%)
Similarity:66/186 (35%) Gaps:56/186 (30%)


  Fly    29 IECLVNRTRVSNVSCHVKAI---------------NWNLAVVNMDCFMIVPLHNPIIR-MQV--- 74
            ||.|...|.||.:..|..||               |:.|.:.|...||.:....||.| ::|   
  Fly    15 IEMLKVCTLVSIIFVHKLAITGAAGKSNFSPTYFENFTLEIQNNTLFMDMTTSKPIHRGLKVLLN 79

  Fly    75 --FTKDYSNQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFK-------RYTNVNHSCPF-SGH 129
              .:.|....|:.....: :..|.|:..        :...|||       ::.|...:||. :||
  Fly    80 TQISLDKGRSYQRLFAHI-LDTCGVVSS--------VRGNLFKSWFDSMLKHGNFMVNCPVPAGH 135

  Fly   130 LIARDGFLDTSLLPPFPQGFYQVSLVVTDTNSTSTDYVGTMKFFLQAMEHIKSKK 184
            ...||..||:.|:|.:               ....||..|..||..  :| |||:
  Fly   136 YFLRDWKLDSHLVPHY---------------MLPGDYCITAHFFFG--KH-KSKQ 172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 20/96 (21%)
CG33767NP_001027141.1 DM8 90..180 CDD:214778 26/111 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C49238
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.