DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33641

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027256.1 Gene:CG33641 / 3771970 FlyBaseID:FBgn0053641 Length:181 Species:Drosophila melanogaster


Alignment Length:194 Identity:45/194 - (23%)
Similarity:83/194 - (42%) Gaps:42/194 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVVLLGCCFIGQLTNTQ------------LVYKLKKIECLVNRTRVSNVSCHVKAINWNLAVVNM 57
            |..:.|..|:..|...:            :.||:..|        ...:.|::...| |.:.||:
  Fly     4 LYFICGLYFLMDLAKCENRRLRIFFDEFAIKYKVPDI--------FEKMDCNLYQAN-NRSYVNV 59

  Fly    58 DCFMIVPLHNPIIR--MQVFTKDYSNQYKPFLVDVKIRICEVIE--RRNFIPYGVIMWKLFKRYT 118
            :..:...:.:..:|  |:.:..:..|:.|  |.||::..|.::.  .:|.:.|..:  |.||:::
  Fly    60 EMKLKKEVSDLNVRAIMEFWKPNAQNKMK--LYDVRVDGCLILRTIHKNKLFYFYV--KSFKKHS 120

  Fly   119 NVNHSCPFSGHLIAR--DGFLDTSLLPPF-PQGFYQVSLVVTDTNSTSTDYVGTMKFFLQAMEH 179
            ||..||||..:...:  |.|||...|||| |.|.::          |.|:|....:..::.:.|
  Fly   121 NVVLSCPFKANFTYKMDDWFLDEEELPPFAPVGQFR----------TVTEYFTQQRLIIRVVAH 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 29/88 (33%)
CG33641NP_001027256.1 DUF1091 80..156 CDD:284008 27/79 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.