DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33783

DIOPT Version :8

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster

Alignment Length:137 Identity:34/137 - (24%)
Similarity:68/137 - (49%) Gaps:18/137 - (13%)


  Fly    25 KLKKIECLVNRTRVSNVSCHVKAINWNLAVVNMDCFMIVPLHNPIIRMQVFTKDYSNQYKPFLVD 89
            :||:.|..|....:..:..|.:|..             :|:::....:.::.:  .|.|:|||.:
  Fly    24 ELKRCELKVLGRGIVGLFLHAQAHQ-------------LPINSSTCILSLYRR--FNGYRPFLYN 73

  Fly    90 VKIRICEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFSGHLIARDGFLDTSLL--PPFPQGFYQV 152
            :.:.||...:.|...|:..:::...|.::|||||||.:..:|.....|:.:::  .|||.|||::
  Fly    74 MTVDICSFFKNRKRYPFVDLVYDAIKNFSNVNHSCPHNHDIIVNRMVLNDNMIVKVPFPSGFYKL 138

  Fly   153 SLVV-TD 158
            ..:: ||
  Fly   139 MFILKTD 145

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 25/83 (30%)
CG33783NP_001027168.1 DUF1091 60..138 CDD:284008 25/79 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C282511
eggNOG 1 0.900 E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.