DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33922

DIOPT Version :8

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster

Alignment Length:150 Identity:40/150 (27%)
Similarity:59/150 (39%) Gaps:49/150 (33%)


  Fly    12 CFIGQLTNTQLVYKLKKIECLVNRTRVSNVSCHVKAINWNLAVVNMDCFMIVPLHNPIIRMQVFT 76
            ||:..:..|...|.| |::.|  :|.||||                             ::.:.|
  Fly    44 CFLKSVNRTYKYYSL-KVKLL--KTPVSNV-----------------------------KINIAT 76

  Fly    77 KDYSNQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFSGHLIARDGFLD--- 138
            ....|.|||||.:|.:..|...:.:...|.....:..||.|:|:|||||:...:|     ||   
  Fly    77 FQRLNGYKPFLYNVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCPYDHDII-----LDKVS 136

  Fly   139 --------TSLLPPFPQGFY 150
                    |::| |.|.|.|
  Fly   137 ISHANTQVTNVL-PVPHGNY 155

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 28/92 (30%)
CG33922NP_001027217.1 DUF1091 72..156 CDD:284008 28/90 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C288856
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.