DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33702

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027120.1 Gene:CG33702 / 3771932 FlyBaseID:FBgn0053702 Length:179 Species:Drosophila melanogaster


Alignment Length:133 Identity:38/133 - (28%)
Similarity:59/133 - (44%) Gaps:19/133 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ECLVNRTRVSNVSCHVKAINWNLAVVNMDCFMIVPLHNPIIRMQVFTKDYSNQYKPFLVDVKIRI 94
            ||::...|.|     |..||:::|:....     |::.....:.:|.|  ||.|:.|||:..|..
  Fly    43 ECILKMVRRS-----VVGINFHIAIKYSQ-----PINKIEFNLSIFRK--SNMYRLFLVNHTIDF 95

  Fly    95 CEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFSGH--LIARDGFLDTS---LLPPFPQGFYQVSL 154
            |..:.|....|...:........||.|||||::..  .:.:..|.|.:   ||...|.|.|:  |
  Fly    96 CYYMRRPEQYPIFYMFHDSLMAATNANHSCPYTEKDIYVKKMTFNDKTLKDLLSFLPVGEYK--L 158

  Fly   155 VVT 157
            ||:
  Fly   159 VVS 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 26/86 (30%)
CG33702NP_001027120.1 DUF1091 73..158 CDD:284008 26/88 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472441
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.840

Return to query results.
Submit another query.