DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33752

DIOPT Version :8

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster

Alignment Length:147 Identity:39/148 (26%)
Similarity:64/148 (43%) Gaps:28/148 (19%)


  Fly    36 TRVSNVSCHVKAINW------NLAVVNMDC--------FMIVPLHNPIIRMQVFTKDYSNQYKPF 86
            ||.:||.|.|...::      .|.|:....        |:.:|:....:...|:.|  .:.|.||
  Fly    24 TRHTNVKCEVLDKSFAEFPVCKLNVLGRGIIAESVYMKFLKLPIKKISVNFTVYKK--LSGYHPF 86

  Fly    87 LVDVKIRICEVIERRNFIPYGVI--MWKLFKRYTNVNHSCPF----SGH-LIARDGFLDTSLLP- 143
            |.:|.:..|..::..|  |..:.  .:...|.|:|.|||||:    |.| ::.:|..|..::.. 
  Fly    87 LFNVTVDFCHYMKHPN--PMNIFHYFYTAVKPYSNFNHSCPYNVSESYHDILVKDFVLTDTMFAK 149

  Fly   144 -PFPQGFYQVSL-VVTD 158
             |.|.|.|..|: :.||
  Fly   150 IPLPTGNYMFSIKLATD 166

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 26/91 (29%)
CG33752NP_001027409.1 DUF1091 72..159 CDD:284008 26/91 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C282569
eggNOG 1 0.900 E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.