powered by:
                   
 
    
    
             
          
            Protein Alignment CG33919 and CG33927
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001027393.1 | Gene: | CG33919 / 3772720 | FlyBaseID: | FBgn0053919 | Length: | 191 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_001027147.1 | Gene: | CG33927 / 3771851 | FlyBaseID: | FBgn0053927 | Length: | 182 | Species: | Drosophila melanogaster | 
        
        
        
          
            | Alignment Length: | 155 | Identity: | 37/155 - (23%) | 
          
            | Similarity: | 70/155 -  (45%) | Gaps: | 27/155 - (17%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly    24 YKLKKIEC-LVNRTRVSNVSCHVKAINWNLAVVNMDCFMIVPLHNPIIRMQVFTKDYSNQYKPFL 87:|.....| .||.|.::...|.:|||......::.:..::..:....:..|:|.:  :|.:||:|
 Fly    28 FKFTNFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVLKTISKFRVHGQIFKR--ANGFKPWL 90
 
 
  Fly    88 VDVKIRICEVIERRNFIPYG---VIMWKLFKRYTNVNHSCPFSG-------HLIARDGFLDTSLL 142.::....|..:.:    ||.   :|::.|.|.::|:|.:||:.|       |:|...       :
 Fly    91 YNITFDGCRFLRK----PYEAPVIIVFNLLKSFSNLNFTCPYMGPVHIMGLHIIGEQ-------I 144
 
 
  Fly   143 P-PFPQGFY--QVSLVVTDTNSTST 164| |.|.|.|  |:...::.|...||
 Fly   145 PVPLPTGEYLIQIKWYISKTLFLST 169
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 1 | 0.930 | - | - |  | C45471956 | 
          
            | Domainoid | 1 | 1.000 | 43 | 1.000 | Domainoid score | I19524 | 
          
            | eggNOG | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Isobase | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 1 | 1.100 | - | - | P | PTHR20898 | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 1 | 1.000 | - | - |  | X90 | 
          
            |  | 5 | 4.940 |  | 
        
      
           
             Return to query results.
             Submit another query.