DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33654

DIOPT Version :8

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster

Alignment Length:145 Identity:35/146 (24%)
Similarity:62/146 (42%) Gaps:33/146 (23%)


  Fly    38 VSNVSCHVKAI-------NW--------NLAVVNMD--------CFMIVPLHN---PIIRMQVFT 76
            :.|..||:..|       .|        ||...:.|        |::.....:   ..:::.:|.
  Fly     2 LKNTRCHIVVILVILLMAKWASSKFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNLFK 66

  Fly    77 KDYSNQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFSGHLIARDGFLD--- 138
            ....|.|:||:.::.:..|..::..:..|.....::.|..|:|:||||||:..||.....:|   
  Fly    67 TPRFNGYRPFMFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIVDKIPIDFVN 131

  Fly   139 ---TSLLPPFPQGFY 150
               |::| |||:|.|
  Fly   132 HRVTNIL-PFPEGDY 145

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 26/88 (30%)
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 26/88 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C298333
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.