DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33689

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster


Alignment Length:138 Identity:34/138 - (24%)
Similarity:66/138 - (47%) Gaps:17/138 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 CHVKAINWNLAVVNMDCFMI-VPLHNPIIRMQVFTKDYSNQYKPFLVDVKIRICEVIERRNFIPY 106
            |.:||:|.....|::...:. :|:.|..|..::...|:.  ||||.:|.....|:.:..:.. |.
  Fly    41 CFIKAVNRTHKYVDVYVNLYKLPIDNITISFRLMRHDHG--YKPFFIDYTFDGCKFLRNQKH-PI 102

  Fly   107 GVIMWKLFKRYTNVNHSCPFSGHLIAR---DGFLDTSLLP--PFPQGFYQVSLVVTDTNSTSTDY 166
            ..:.:|:::..:|:||:||:...:|..   .|.:::..|.  |...|.|.|      .::.|||.
  Fly   103 IKLFYKIYQGSSNINHTCPYDHDIIVDHLWTGNIESDFLKYIPMINGDYAV------YSNWSTDN 161

  Fly   167 VGTMKFFL 174
            :  |:.:|
  Fly   162 I--MRAYL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 21/86 (24%)
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 20/82 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
33.010

Return to query results.
Submit another query.