DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33631

DIOPT Version :8

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027167.1 Gene:CG33631 / 3771784 FlyBaseID:FBgn0053631 Length:195 Species:Drosophila melanogaster

Alignment Length:150 Identity:29/150 (19%)
Similarity:53/150 (35%) Gaps:37/150 (25%)


  Fly    65 LHNPIIR---MQVFTKDYSNQYKPFLVDVKIRICEVIERR-----NFIPYGVIMWKLFKRYTNVN 121
            :..||:|   :.:|......:...::.:.:::....|..|     ||:.:.:   |:..|.|...
  Fly    35 VQKPILRIHHINIFGDSRFMKALSYIDETRLKFTIFISLREELGSNFLTFNI---KIRVRPTGRT 96

  Fly   122 HSCPFSGHLIARD----GFLDTSLLPPFPQGFYQVSLVVTD-------------TNSTSTDYV-- 167
            :   |...|..||    ||.......|..:.|.|..:.::|             .|.:..|..  
  Fly    97 N---FVTLLQMRDLDLCGFFTEFRKNPMMKYFLQSEMQLSDIIVCPVRVGNYSVKNVSVKDIYPQ 158

  Fly   168 ----GTMKFFLQAMEHIKSK 183
                |..|||::.:|....|
  Fly   159 VLQNGIYKFFVEVIEATAEK 178

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 18/94 (19%)
CG33631NP_001027167.1 DUF1091 84..167 CDD:284008 17/89 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.