DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33642

DIOPT Version :8

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001027257.1 Gene:CG33642 / 3771733 FlyBaseID:FBgn0053642 Length:187 Species:Drosophila melanogaster

Alignment Length:189 Identity:48/190 (25%)
Similarity:78/190 (41%) Gaps:54/190 (28%)


  Fly    31 CLVNRTRVSNVSCHVKAINWNL--AVVNMDCFMIVPLHN-------PIIRMQV------FTKDY- 79
            ||....|...:..:..|:.:.:  .:.::| |.||.|:|       .|::..|      .|.|: 
  Fly    20 CLKCEERSFRIKMNEFAVKYKMRDLIQHID-FRIVNLNNRSYVNGEMIVKSDVEDILMHTTMDFW 83

  Fly    80 --SNQYKPFLVDVKIRICEVIE--RRNFIPYGV--IMWKLFKRYTNVNHSCPFSGHLIARDGF-- 136
              |||.|..|.|.::..|:.::  .||    |:  |..|.||::.:.|.|||.      |..|  
  Fly    84 KTSNQKKIKLYDGRLDACQFLKTSHRN----GLFKIYVKSFKKHIHGNLSCPL------RTNFNY 138

  Fly   137 ------LDTSLLPPF-PQGFYQVSLVVTDTNSTSTDYVGTMKFFLQAMEH--IKSKKTH 186
                  :|...|||| |.|.::          |.|:|....:..|:.:..  :.|.||:
  Fly   139 TLTNWHMDEKDLPPFVPLGTFR----------TVTEYFTQDRLALRIVTQGKVLSYKTN 187

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 30/104 (29%)
CG33642NP_001027257.1 DUF1091 79..160 CDD:284008 29/91 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.