DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG13193

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster


Alignment Length:154 Identity:38/154 - (24%)
Similarity:67/154 - (43%) Gaps:32/154 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RTRVSNVS--C---HVKAI-NWNLA--VVNMDCFMIVPLHN----PIIRMQVFTKDYSNQYKPFL 87
            |::.:|:|  |   :..:| .|..|  .:|:|..:...|.|    .|..:|:.  |..::|:. |
  Fly    34 RSKFTNISVECSKDYCSSIRGWLTAKGELNLDIHLNRTLKNGLRTTITLLQLI--DGKDRYQT-L 95

  Fly    88 VDVKIRICEVIERRNFIPYGVI-MW--KLFKRYTNVNHSCPFS-GHLIARDGFLDTSLLPPF-PQ 147
            ....:..|:.:  |..:...:: :|  .:|| |.|:...||.. .....|:..|:...:|.: |.
  Fly    96 FSYDMDTCKTL--RELLQSSLMKVWLRNVFK-YGNLADRCPIQPASYDVRNFQLENHSIPGYLPA 157

  Fly   148 GFYQVSLVVTDTNSTSTDYVGTMK 171
            |||::.    |||     |.|..|
  Fly   158 GFYRLH----DTN-----YYGKPK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 20/86 (23%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 24/95 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447875
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.