DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG12898

DIOPT Version :10

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_610581.1 Gene:CG12898 / 36096 FlyBaseID:FBgn0033516 Length:156 Species:Drosophila melanogaster


Alignment Length:89 Identity:21/89 - (23%)
Similarity:41/89 - (46%) Gaps:21/89 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 FLVDVKIRI---------CEVIERRNFIPYGVIMWKLFKRYTN---VNHS---CPFSG--HLIAR 133
            |.:|:.:::         .|.|:..:|: ...:::|:|....|   ||.|   ||...  :.:..
  Fly    48 FTIDITVKVVKTQRIFYKMENIKGCDFL-NNPLLFKMFGEVYNHLVVNGSYFKCPIKPKVYYLKN 111

  Fly   134 DGFLDTSLLPPF-PQGFYQVSLVV 156
            :|  ..|::|.. |.|.:|:|:.|
  Fly   112 EG--TVSIIPSIHPPGRFQLSMRV 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:461928 18/83 (22%)
CG12898NP_610581.1 DUF1091 58..129 CDD:461928 16/73 (22%)

Return to query results.
Submit another query.