DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33467

DIOPT Version :8

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster

Alignment Length:184 Identity:107/184 - (58%)
Similarity:147/184 - (79%) Gaps:1/184 - (0%)


  Fly     1 MKLVLVVLLGCCFIGQLTNTQLVYKLKKIECLVNRTRVSNVSCHVKAINWNLAVVNMDCFMIVPL 65
            |....:|||..||||.:|::|||||..|:||..|:.||.||||:||.||||.|:||:||::|.||
  Fly     1 MPYTWLVLLSICFIGHMTDSQLVYKFTKVECQGNQARVKNVSCNVKPINWNTALVNLDCYLIYPL 65

  Fly    66 HNPIIRMQVFTKDYSNQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFSGHL 130
            .||.||:|||.|||||||||||:|...::|:|:||:||:||.|::|:||:|:|||. ||..||.|
  Fly    66 INPTIRVQVFMKDYSNQYKPFLIDATFKLCDVVERKNFLPYAVMVWELFQRFTNVK-SCHISGQL 129

  Fly   131 IARDGFLDTSLLPPFPQGFYQVSLVVTDTNSTSTDYVGTMKFFLQAMEHIKSKK 184
            .||:|:|::|.:||||.|.||:|::.:|:|||:.::||.:|||:|||:.||.||
  Fly   130 SARNGYLNSSYVPPFPHGQYQISVMFSDSNSTNREFVGIVKFFVQAMDEIKIKK 183

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 49/81 (60%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:284008 49/81 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C280595
eggNOG 1 0.900 E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20898
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.