DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33467

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster


Alignment Length:184 Identity:107/184 - (58%)
Similarity:147/184 - (79%) Gaps:1/184 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLVLVVLLGCCFIGQLTNTQLVYKLKKIECLVNRTRVSNVSCHVKAINWNLAVVNMDCFMIVPL 65
            |....:|||..||||.:|::|||||..|:||..|:.||.||||:||.||||.|:||:||::|.||
  Fly     1 MPYTWLVLLSICFIGHMTDSQLVYKFTKVECQGNQARVKNVSCNVKPINWNTALVNLDCYLIYPL 65

  Fly    66 HNPIIRMQVFTKDYSNQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFSGHL 130
            .||.||:|||.|||||||||||:|...::|:|:||:||:||.|::|:||:|:|||. ||..||.|
  Fly    66 INPTIRVQVFMKDYSNQYKPFLIDATFKLCDVVERKNFLPYAVMVWELFQRFTNVK-SCHISGQL 129

  Fly   131 IARDGFLDTSLLPPFPQGFYQVSLVVTDTNSTSTDYVGTMKFFLQAMEHIKSKK 184
            .||:|:|::|.:||||.|.||:|::.:|:|||:.::||.:|||:|||:.||.||
  Fly   130 SARNGYLNSSYVPPFPHGQYQISVMFSDSNSTNREFVGIVKFFVQAMDEIKIKK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 49/81 (60%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:284008 49/81 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471920
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014288
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.