DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33477

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_995797.1 Gene:CG33477 / 2768726 FlyBaseID:FBgn0053477 Length:198 Species:Drosophila melanogaster


Alignment Length:85 Identity:20/85 - (23%)
Similarity:39/85 - (45%) Gaps:13/85 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GCCFIGQLTNTQLVYKL--KKIECLVNRTRVSNVSCHVKAINWNLAVVNMDCFM-IVPLHNPIIR 71
            ||.|:    |..:::|:  :..:.||  ...|...|.:|.   |:..:..|..| ::|..:|..|
  Fly   113 GCEFL----NNPVIFKMFGESYKTLV--VNGSYFKCPIKP---NVYYLKTDGIMSMIPSVHPFGR 168

  Fly    72 MQVFTK-DYSNQYKPFLVDV 90
            .|:..: ......|||::::
  Fly   169 FQLSMRVKMKESRKPFVMEM 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 5/22 (23%)
CG33477NP_995797.1 DUF1091 100..171 CDD:284008 16/66 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.