DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and CG33475

DIOPT Version :10

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_995799.1 Gene:CG33475 / 2768724 FlyBaseID:FBgn0053475 Length:147 Species:Drosophila melanogaster


Alignment Length:84 Identity:19/84 - (22%)
Similarity:37/84 - (44%) Gaps:23/84 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LTNTQL---VYKLKKIECLVNRTRVSNVSCHVKAINWNLAVVNMDCFMIVPLHNPIIRMQVFTKD 78
            :.:|:|   ::...:|:..|:...:.|:.        |||:.|.       |:|.:|     :|.
  Fly    32 INSTKLFKNIFLDNRIQNAVSNRTIYNIK--------NLAICNF-------LNNRLI-----SKV 76

  Fly    79 YSNQYKPFLVDVKIRICEV 97
            ||..|:.|:.:..:..|.|
  Fly    77 YSVIYEGFVGNSTVFRCPV 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:461928 8/28 (29%)
CG33475NP_995799.1 DUF1091 52..122 CDD:461928 15/64 (23%)

Return to query results.
Submit another query.