DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and AgaP_AGAP013264

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_003436195.1 Gene:AgaP_AGAP013264 / 11176096 VectorBaseID:AGAP013264 Length:209 Species:Anopheles gambiae


Alignment Length:153 Identity:31/153 - (20%)
Similarity:66/153 - (43%) Gaps:14/153 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IGQLTNTQLVYKLKKIECL---VNRTRVSNVSCHVKAINWNLAVVNMDCFMIVPLHNPIIRMQVF 75
            :|..||:. |.::.|::|:   ..||::.    :.|.|.:....|.::..:.:|  ..:...:|.
Mosquito    37 LGNTTNSH-VLRITKLQCIEAPYKRTQLD----YCKMIQFPNGTVGLNTSVTIP--QVLNYFEVT 94

  Fly    76 TKDY--SNQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKR-YTNVNHSCPFSGHLIARDGFL 137
            .|.|  ...|:||::|..|.:|:......:.|...::.::.:. .....:.||......|.....
Mosquito    95 AKLYYKYKTYRPFMIDWSIELCQAERIGKYNPSTALVMRIMEESVPEFYYPCPHGNRTYATFWMF 159

  Fly   138 DTSLLP-PFPQGFYQVSLVVTDT 159
            :.|.:| ..|.|.|::.:...|:
Mosquito   160 EPSYIPSTLPSGDYRLDVFFRDS 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 18/85 (21%)
AgaP_AGAP013264XP_003436195.1 DUF1091 93..175 CDD:284008 18/81 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20898
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.