DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and AgaP_AGAP013517

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_003436185.1 Gene:AgaP_AGAP013517 / 11175926 VectorBaseID:AGAP013517 Length:203 Species:Anopheles gambiae


Alignment Length:203 Identity:48/203 - (23%)
Similarity:79/203 - (38%) Gaps:58/203 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVVLLGCCFIGQLTNTQLVYKLKKIECLVNRTRVSNVSCHVKAINWNLAVVNM--------DCFM 61
            |.|||..| .|........|:.:|     |.:|...:..|      .|..::.        :|.|
Mosquito    11 LGVLLWTC-AGVFAQNVFNYEEQK-----NLSRSYTIQVH------RLLCIDAPYKETILHECRM 63

  Fly    62 I----------VPLHNP------IIRMQVFTKDYSNQYKPFLVDVKIRICEVIERRNFIP----- 105
            |          |.|..|      :|:.|:..|..  :|:|||:|:|...||::..|...|     
Mosquito    64 IFRRNQRPLLNVSLEAPKKYNYLMIQFQLHYKFI--KYQPFLIDIKAEGCELMRDRKNDPTRRWM 126

  Fly   106 YGVIMWKLFKRYTNVNHSCPF-----SGHLIARDGFLDTSLLPPFPQGFYQVSLVVTDTNSTSTD 165
            |||:.    ...:::.|.|||     ||.:..::.:...|:    |.|.|::..:.  |:.|:..
Mosquito   127 YGVMQ----DLMSSIVHPCPFGNRTYSGLVSLKEEYAPRSV----PAGEYRMDGIF--TSQTNVT 181

  Fly   166 YVGTMKFF 173
            .:....||
Mosquito   182 LLSMQLFF 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 26/91 (29%)
AgaP_AGAP013517XP_003436185.1 DUF1091 88..170 CDD:284008 26/91 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20898
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.