DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and AgaP_AGAP013448

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_003436199.1 Gene:AgaP_AGAP013448 / 11175706 VectorBaseID:AGAP013448 Length:203 Species:Anopheles gambiae


Alignment Length:176 Identity:39/176 - (22%)
Similarity:81/176 - (46%) Gaps:23/176 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVLVVLLGCCFI--------GQL----TNTQLVYKLK--KIECL---VNRTRVSNVSCHVKAINW 50
            |:|:.||....:        .||    |.:.:.:||:  |::|.   ...|::.:  |:::.:..
Mosquito    11 LILLCLLAHALLWSPVLQTTAQLKRKPTKSGVSHKLRVSKLQCANAPYKHTQLHH--CYMEQMPN 73

  Fly    51 NLAVVNMDCFMIVPLHNPIIRMQVFTKDYSNQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFK 115
            ....:|:...|.:.::...|.:|:|.| |:. |:||:||..:..|:....|:|.|...:|.::.:
Mosquito    74 GTVGLNISLTMPMVVNYLGIVVQLFYK-YTT-YRPFMVDWNMEYCQAARNRHFSPTTAVMMRIIE 136

  Fly   116 R-YTNVNHSCPFSGHLIARDGFLDTS-LLPPFPQGFYQVSLVVTDT 159
            . ..:..:.||......|.....:.. :||..|.|.|::.:.:.|:
Mosquito   137 ETLPDFYYPCPHGNRTYATLWMFEPKHVLPTLPSGDYRMDIYLRDS 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 23/83 (28%)
AgaP_AGAP013448XP_003436199.1 DUF1091 93..175 CDD:301369 23/83 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20898
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.