DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and AgaP_AGAP013050

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_003436196.1 Gene:AgaP_AGAP013050 / 11175660 VectorBaseID:AGAP013050 Length:204 Species:Anopheles gambiae


Alignment Length:196 Identity:44/196 - (22%)
Similarity:84/196 - (42%) Gaps:25/196 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVLVVLLGCCFIGQLTNTQLVY--KLKKIECL---VNRTRVSNVSCHVKAINWNLAVVNMDCFMI 62
            |:|:||.|....|:.....:.|  ::.|::|:   ..||.::    :.|.|.:....|.::..:.
Mosquito    24 LLLIVLSGSGNAGKQDKNGISYIMRITKLQCIEAPYKRTHLN----YCKMIQFPNGTVALNTSLT 84

  Fly    63 VPL--HNPIIRMQVFTKDYSNQYKPFLVDVKIRICEVIERRNFIPYGVIMWKLFKR-YTNVNHSC 124
            ||:  :...|..::|.| |.. |:||:||..|..|:...:....|...||.|:.:. ..:..:.|
Mosquito    85 VPMLVNYAEIVAKLFYK-YKT-YRPFMVDWSIDYCQAARKGTLNPTAAIMMKIAENSMPDYYYPC 147

  Fly   125 PFSGHLIARDGFLDTSLLP-PFPQGFYQVSLVVTDTNSTSTDYVGTMKFFLQAMEHIKSKKTHNL 188
            |......|.....:.|.:| ..|.|.|::.:...|::          :..|.|::...|.:...|
Mosquito   148 PHGNRTYATYWTFEPSYIPTTLPSGDYRLDIYFRDSS----------RITLYALQMFASIRKQGL 202

  Fly   189 V 189
            :
Mosquito   203 I 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 23/83 (28%)
AgaP_AGAP013050XP_003436196.1 DUF1091 94..176 CDD:284008 23/83 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20898
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.