DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33919 and AgaP_AGAP012968

DIOPT Version :9

Sequence 1:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_003436051.1 Gene:AgaP_AGAP012968 / 11175598 VectorBaseID:AGAP012968 Length:119 Species:Anopheles gambiae


Alignment Length:80 Identity:17/80 - (21%)
Similarity:34/80 - (42%) Gaps:7/80 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 NQY---KPFLVDVKIRICEVIERRNFI--PYGVIMWKLFK-RYTNVNHSCPFSGHLIARDGFLDT 139
            :||   :.:|.......||.:......  |...:::.:.| ::......||.||.:...:..:|.
Mosquito     7 SQYQHTRTYLFGTTFDYCEYMSSTESYHNPVAKLVYAVAKLKFPQALLQCPASGVVNITNMKIDE 71

  Fly   140 SLLPP-FPQGFYQVS 153
            :|.|| .|.|.::.:
Mosquito    72 NLAPPIMPTGRFRTN 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 17/77 (22%)
AgaP_AGAP012968XP_003436051.1 DUF1091 13..84 CDD:284008 15/70 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20898
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.