DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33964 and METTL25

Sequence 1:NP_001033941.1 Gene:CG33964 FlyBaseID:FBgn0053964 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_115606.2 Gene:METTL25 HGNCID:26228 Length:603 Species:Homo sapiens

Alignment Length:611 Identity:171/612 (28%)
Similarity:268/612 (44%) Gaps:152/612 (25%)


  Fly     9 LQRRLDGLLAFLNPHWDFVNCHMVNYLTDQHWDGFLS---ETLKSEI--AGKEDVALAIE----- 63
            |:.:|.|||.||.......|.|.|::.|:..|:..:.   ||:.:.:  :..|..||..|     
Human    16 LRAKLQGLLQFLRDALSISNAHTVDFYTESVWEELVDLPPETVLAALRKSASETEALPSETRPLV 80

  Fly    64 DLFWKTDESERFPAWREFLGKSKQ----ERLSLHPK--------LLTSVEELIEG-QGNSTQ--- 112
            :..|:...:: ||  :.|...|::    |..:|..|        :.|..|:|:.. :||..|   
Human    81 EAEWEAGMTD-FP--KIFCETSQKLVSVEAFALAAKYYSVQNLGICTPFEQLLVALRGNQNQRIG 142

  Fly   113 --LSIREFMSAKKCHEVDLTAVLVDQLVKNSG--QDCFIVDAGDGKGYLSSRLALQYGHRVLGID 173
              ....|||:.||.|||...:.|:..:....|  |   ::|.|.|||||||.|:|:||.:|.|||
Human   143 ENQKAVEFMNMKKSHEVQAMSELISSIADYYGIKQ---VIDLGSGKGYLSSFLSLKYGLKVYGID 204

  Fly   174 ANAANTENALNRNRKLQRAWNGLTERAELQVQGIT---PKRRSKKSPARESTKSAPALENYKTTA 235
            ::..||..|..|||||::.|.....::.|.|.|:.   .|.|..::..:....:.....|..|..
Human   205 SSNTNTHGAEERNRKLKKHWKLCHAQSRLDVNGLALKMAKERKVQNKVKNKADTEEVFNNSPTNQ 269

  Fly   236 KFITTEL---NFGALLAENF------TQFRPEDSPNIC--------------------------- 264
            :.:.|..   :|...:..|.      ...:|....|:|                           
Human   270 EKMPTSAILPDFSGSVISNIRNQMETLHSQPHQEENLCFENSFSLINLLPINAVEPTSSQQIPNR 334

  Fly   265 ----------------------------------------------LTGLHTCGNLAATCLQVFH 283
                                                          :.||||||:||...|::|.
Human   335 ETSEANKERRKMTSKSSESNIYSPLTSFITADSELHDIIKDLEDCLMVGLHTCGDLAPNTLRIFT 399

  Fly   284 AQTDCRLLCNVGCCYHLLRERYSQQEFFGNKSLMELQTDYGFPLSQYLRERQVRMGRNARMLAAQ 348
            :.::.:.:|:||||||||.|.      |.|:.....|..:|||:..||:|.:...||||||.|..
Human   400 SNSEIKGVCSVGCCYHLLSEE------FENQHKERTQEKWGFPMCHYLKEERWCCGRNARMSACL 458

  Fly   349 SIERTLDTKELPNVTLYYRALLEILVCRHAPELKNELQVGKV-RKFESFEEYIQKCATKLDAPWL 412
            ::||....:.||..:|:|||:|:.::.......|.:..|||: .|..||.:|:::...||...  
Human   459 ALERVAAGQGLPTESLFYRAVLQDIIKDCYGITKCDRHVGKIYSKCSSFLDYVRRSLKKLGLD-- 521

  Fly   413 AAVEKEELQSLLQEYAVHKYF---------LDLFYLLRMSFAPVLESLILLDRLLYLKE---LGY 465
                    :|.|.|..:..|:         |:.|.:|::..||.:|:|||||||.||||   :.:
Human   522 --------ESKLPEKIIMNYYEKYKPRMNELEAFNMLKVVLAPCIETLILLDRLCYLKEQEDIAW 578

  Fly   466 ERSYLIDLFDPVISPRHFAIVSIKQQ 491
              |.|:.|||||.|||.:|::::|:|
Human   579 --SALVKLFDPVKSPRCYAVIALKKQ 602

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33964NP_001033941.1 Methyltransf_32 122..304 CDD:290402 67/269 (25%)
METTL25NP_115606.2 AdoMet_MTases 154..420 CDD:302624 67/269 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2651
Hieranoid 1 1.000
Homologene 1 1.000 H32774
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007533
OrthoInspector 1 1.000 T1073191
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12496
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.880

Return to query results.
Submit another query.