DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33964 and AT1G16650

Sequence 1:NP_001033941.1 Gene:CG33964 FlyBaseID:FBgn0053964 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001320893.1 Gene:AT1G16650 AraportID:AT1G16650 Length:529 Species:Arabidopsis thaliana

Alignment Length:560 Identity:149/561 (27%)
Similarity:247/561 (44%) Gaps:136/561 (24%)


  Fly    13 LDGLLAFLNPHWDFVNCHMVNYLTDQHWDGFLSE---TLKSE---------IAGKEDVALAIEDL 65
            :..::.||.|....:|.|:||:..|:.|:....|   .||.|         ..|.:|...|....
plant    18 ITAIIDFLKPFSFLINAHVVNFFKDKQWEAVNEEWMSCLKDEKPENILLIPSGGVQDHWPASLKK 82

  Fly    66 FWKTDESERFPAWREFLGKSKQERLSLHPKLLTSVEELIEGQGNSTQLSIREFMSAKKCHE---- 126
            |..|..|..||          :|:..|. .:|..|:.:    ..||.||  :.|:.||.||    
plant    83 FVHTLRSLSFP----------REQADLQ-AILADVDMV----PLSTVLS--QGMNLKKKHEVTYY 130

  Fly   127 ----VDLTAVLVDQLVKNSGQDCFIVDAGDGKGYLSSRLALQYGHRVLGIDANAANTENALNRNR 187
                |::.:.:|..:||:.|... :||.|.|:|||:..|:.||.|.|:.||:::.:.:....|..
plant   131 GIMQVEVLSSVVSSVVKSVGAPT-VVDVGAGQGYLAQVLSFQYKHSVVAIDSSSHHGKVTDARAA 194

  Fly   188 KLQRAWNGLTERAELQVQGITPKRRSKKSPARESTKSAPALENYKTTAKFITTEL---------- 242
            ::::.:     .|:::..|     ...|.|....|          .|.:.::||:          
plant   195 RIKKHF-----AAQMRKSG-----SGNKCPDVPMT----------ITCRVLSTEMLKALTDVHLE 239

  Fly   243 -----NFGALLAENFTQFRPEDSP------NICLTGLHTCGNLAATCLQVFHAQTDCRLLCNVGC 296
                 :.|:.|.|. .|.|.:.|.      ::.|.|||.||:|:.|.|:.|....:.:.|.::||
plant   240 KDETDSSGSALNEE-GQSRSQSSSDANRSCSLVLAGLHACGDLSVTMLRTFMECEEVKALVSIGC 303

  Fly   297 CYHLLRERYSQQEFFGNKSLMELQTDYGFPLSQYLRERQVRMGRNARMLAAQSIERTLDTKE--- 358
            ||:||.|:.|:...          :..|:|:|..||.....:|:|||.||.||.||.....|   
plant   304 CYNLLSEKSSEDSC----------SKCGYPMSAGLRSLGFSLGKNARDLACQSAERWSSLGEDAG 358

  Fly   359 LPNVTLY-YRALLEILVCRHAPE-LKNELQVGKVRKFESFEEYIQKCA----------------- 404
            |.|..|: :||..::::.:|.|| |.....:|  |:.::|....|:.:                 
plant   359 LQNFELHSFRAAFQMVLSKHYPEVLATSPSIG--RQGKAFRRQQQRKSLETPAAVDTTRKDTVDK 421

  Fly   405 -----TKLDAPWLAAVEKEELQSLLQEYAVHKYFLDL----------------FYLLRMSFAPVL 448
                 |.|::...::.||..|.:..:....|...|||                ::.:|.:..|||
plant   422 KPMRQTSLNSDMCSSFEKFCLSAFSRLNLEHPRDLDLNATWNEADAFTELIGPYWSIRAALGPVL 486

  Fly   449 ESLILLDRLLYLKELGYE-RSYLIDLFDPVISPRHFAIVS 487
            |:|||||||::|:|.|.. :..::.:|||.||||:.||::
plant   487 ETLILLDRLMFLQEQGDSIKVVMLPIFDPTISPRNVAIIA 526

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33964NP_001033941.1 Methyltransf_32 122..304 CDD:290402 56/211 (27%)
AT1G16650NP_001320893.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I1721
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12496
Phylome 1 0.910 0.769 Consistency score
55.070

Return to query results.
Submit another query.