DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33964 and ORC3

Sequence 1:NP_001033941.1 Gene:CG33964 FlyBaseID:FBgn0053964 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_197171.2 Gene:ORC3 AraportID:AT5G16690 Length:734 Species:Arabidopsis thaliana

Alignment Length:487 Identity:89/488 (18%)
Similarity:152/488 (31%) Gaps:197/488 (40%)


  Fly    12 RLDGLL--AFLNPHWDFVNCHMV-----NYLTDQHWDGFLSETLKSEIAGKEDVALAIEDLFWKT 69
            |:|.:|  .||.|...|...|.|     :|...|  ||.|:..:::         |.|..|    
plant   306 RMDAVLKAVFLKPCSGFTVSHKVALFMRSYFLCQ--DGTLTSFVRT---------LKIACL---- 355

  Fly    70 DESERFPAWREFLGKSKQERLSLHPKLL-------TSVEELIEGQGNSTQLSIREFMSAKKCHEV 127
                              :..||.|..:       ..|.:|   .|..|:|.....|.    |..
plant   356 ------------------QHFSLEPLSIMLEHFCHDGVNQL---SGEGTELLTEATMK----HAF 395

  Fly   128 DLTAVLVDQLVKNSGQ--DCFIVD-----------------AGDGKGYLSSRLA----------- 162
            ||.:|..:::.:::.:  ..|::|                 ||.   :...||.           
plant   396 DLPSVTRNKITRSTFEMLPHFLLDLQRMPNPWSIVVLCLYEAGK---FDKLRLLDIFCEILDPEA 457

  Fly   163 --LQY--GHRVLGIDANAANTENALNR-NRKLQ-----------RAWNGLT-ERAEL-------- 202
              |:|  ...::...::.:...|.:.| .|||:           ::|..|| |..|:        
plant   458 RYLKYFSPSEIVNSQSHNSGRNNVIRRVLRKLRDLSPSQLSSMLKSWENLTAEFTEINDKVIELH 522

  Fly   203 ----------QVQGI--TPKRRSKKSPARESTKSAPALENYKTTAKFITTE-------LNFGALL 248
                      |.||:  :||:.:.:|.::...:.....:...|..:|:..|       :.|..:|
plant   523 PFMRAVEAAGQRQGLPNSPKKHASRSNSKLEKELKAMTDKVATVIEFMLREYMKPVESVPFHEIL 587

  Fly   249 AENFTQFRPEDSPNICLTG----------------LH--TCGNLAATCLQVFHAQTDCRLLCNVG 295
            .     |:..|.....|.|                ||  .|.....|.|...|   |..:|    
plant   588 C-----FKNVDKLQSALLGDPRGRIQLDLLESHDILHCVCCSQRGTTLLPSMH---DTSIL---- 640

  Fly   296 CCYHLLRERYS-------QQEFFGNKSLMELQTDYGFPLSQYLRERQVRMGRNARMLAAQSIERT 353
              |.|.:|...       .|.|   |:::       .|.|...:::            ::|..::
plant   641 --YKLAQEHADVINLHDWYQSF---KTIL-------IPRSSKAKQK------------SKSSSKS 681

  Fly   354 LDTKEL---PNVTLYYRALLEILVCRHAPELK 382
            ...||:   |....  .||::...||...||:
plant   682 KKRKEICEEPEAPA--EALIQARFCRAVMELQ 711

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33964NP_001033941.1 Methyltransf_32 122..304 CDD:290402 48/274 (18%)
ORC3NP_197171.2 ORC3_N 82..366 CDD:284456 20/93 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
10.910

Return to query results.
Submit another query.