DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33964 and rrnad1

Sequence 1:NP_001033941.1 Gene:CG33964 FlyBaseID:FBgn0053964 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001082903.1 Gene:rrnad1 ZFINID:ZDB-GENE-050522-515 Length:574 Species:Danio rerio

Alignment Length:607 Identity:149/608 (25%)
Similarity:245/608 (40%) Gaps:172/608 (28%)


  Fly     8 QLQRRLDGLLAFLNPHWDFVNCHMVNYLTDQHWDGFLSETLKSEIAGKEDVALAIEDLFWKTDES 72
            :|..:|..||:            ...:::|.:...|.||:|                  |:|   
Zfish    13 ELAEKLTSLLS------------TYRHISDSYIIEFFSESL------------------WET--- 44

  Fly    73 ERFP-AWREFLG--------------KSKQERL-SLHP----KLLTSVEELI------------- 104
              .| :|:|.||              |.|..|. |:.|    .|.|:...|.             
Zfish    45 --LPVSWQEALGDLTPPMIADLLLDDKIKDRRYSSVWPLSLLALRTAAHALTFPRTTPGGHQQNA 107

  Fly   105 -----EGQGNSTQLSI-----REFMSAKKCHEVDLTAVLVDQLVKNSGQDCFIVDAGDGKGYLSS 159
                 |.|.|.:|.|:     |:.:..||.||:....:||.:|...:..:| :||.|.|:|:|:.
Zfish   108 GVAAEEFQSNHSQSSLLGHIFRKHVKPKKQHEIRRLGMLVKELCDQANCNC-VVDVGSGQGHLTR 171

  Fly   160 RLALQYGHRVLGIDANAANTENALNRNRKL----------------------------------Q 190
            .|:...|..|.||:|:......|...:|:|                                  :
Zfish   172 FLSFGLGLHVTGIEADPNLVSMATKFDRQLLQTLTKENQSSGKAHVLRSEPGPPPRHVVGWVNPK 236

  Fly   191 RAWN------GLTERAELQVQGITPKRRSKK----SPARESTKSAP---ALENYKTTAKFITTEL 242
            .:|:      |:|......:...|.|::..:    .|....||:..   .|.:.||.::..|:..
Zfish   237 ASWDVFIQQLGMTATESDSIGATTEKKQRVEDLHLEPLSCQTKAEDLQNTLHSQKTASQTNTSIF 301

  Fly   243 NFGA---LLAENFTQFRPEDSPNICLTGLHTCGNLAATCLQVFHAQTDC---RLLCNVGCCYHLL 301
            ..|.   :|..........|..:..|||||.||:|:||.|:.|   |:|   .::.:|.|||..:
Zfish   302 PSGTATEMLTCKTIPIPKRDPGSFVLTGLHACGDLSATLLRHF---TNCPHVNVITSVACCYMKI 363

  Fly   302 RERYS-------QQEFFGNKSLMELQTDYGFPLSQYLRE-RQVRMGRNARMLAAQSIERTLDTKE 358
            ..:.:       |..||.:.:..:..:::|:|:|.::|. ...::...||..|..:||..|....
Zfish   364 STKENPNPPGVFQPPFFSDITTADFCSEFGYPMSNWVRGLTGHQLSYKAREGACHAIEEYLQRLR 428

  Fly   359 LPNVTL---YYRALLEILVCRHAPELKNE-LQVGKVRKFESFEE------YIQKCA--------T 405
            ..:..|   .|||:||.::..|.|:::.. :|..|.....||.|      :|:|.|        .
Zfish   429 EESTLLRTHCYRAILENIIRAHRPDIRRPGVQTVKKAHMLSFSELVTFFCHIRKYARLALPRVGL 493

  Fly   406 KLDAPW-LAAVEKEELQSLLQEYAVHKYFLDLFYLLRMSFAPVLESLILLDRLLYLKELGYERSY 469
            ..|.|: ...|:    ..|.|:..|..|| .|..||    |||:|:|:||||:::|:|.|:: |.
Zfish   494 PADLPFDPVCVD----AMLAQQGKVVAYF-SLVLLL----APVVETLVLLDRIIFLQERGFQ-SK 548

  Fly   470 LIDLFDPVISPRHFAIVSIKQQ 491
            ||.|||...|||:..:|::|.:
Zfish   549 LIPLFDAAFSPRNLVLVAVKSE 570

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33964NP_001033941.1 Methyltransf_32 122..304 CDD:290402 56/235 (24%)
rrnad1NP_001082903.1 AdoMet_MTases 135..365 CDD:302624 56/234 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5160
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.