DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33964 and mettl25

Sequence 1:NP_001033941.1 Gene:CG33964 FlyBaseID:FBgn0053964 Length:484 Species:Drosophila melanogaster
Sequence 2:XP_004912966.1 Gene:mettl25 XenbaseID:XB-GENE-5864940 Length:584 Species:Xenopus tropicalis

Alignment Length:611 Identity:174/612 (28%)
Similarity:279/612 (46%) Gaps:153/612 (25%)


  Fly     1 MSKVGVVQLQRRLDGLLAFLNPHWDFVNCHMVNYLTDQHWDGFLS---ETLKSEIA--------- 53
            :.:|...||:..:..||.||:........|.|::.|...|...::   ||:.|..:         
 Frog     5 LCEVSTDQLKEAVKKLLQFLHETLQISGAHTVDFYTQDIWKKLVAVSPETVLSAFSKHNGTSHHI 69

  Fly    54 GKEDVALAIEDLFWKTDESERFPAWREFLGKSKQERLSLHPKLLTSVEELIEG----QGNSTQLS 114
            |||...|:  .:|    .:::......|:..|....| ::..:.|||:||:|.    :..|..|.
 Frog    70 GKEVPELS--SIF----SNQQLVNIEAFVEASHSHSL-VNMGICTSVDELLEALAVHKAGSPDLK 127

  Fly   115 IREFMSAKKCHEVDLTAVLVDQLVKNSGQDC---FIVDAGDGKGYLSSRLALQYGHRVLGIDANA 176
            ..:||:.||.|||    :::.|||::....|   .::|.|.|||||||.|:::|..:|.|||::.
 Frog   128 TDQFMNDKKLHEV----LIMSQLVQSIANICGVKQVIDLGAGKGYLSSYLSMKYNLKVYGIDSSD 188

  Fly   177 ANTENALNRNRKLQRAWNGL------------------------------TERAELQVQGITPK- 210
            .||:.|..||:||::.|...                              |:|...:.:...|| 
 Frog   189 TNTDGANRRNQKLKKYWKTYKTDAREVSKAQESDQNKDCLLPNYSCQEVNTDREIPKPKSCFPKL 253

  Fly   211 -----------------RRSKKSPAR-----ESTKSAPAL----------------------ENY 231
                             :|.:::..|     :|.:|:|.|                      |..
 Frog   254 EESSISNDLKSINVSEWKRDQENYQRTLQPADSDRSSPFLDILPADAVEEQTFSKSVHKSLSEQE 318

  Fly   232 KTTAKF--------------------ITTELNFGALLAENFTQFRPEDSPNICLTGLHTCGNLAA 276
            |...|.                    ||.|.....::         ||.....:.||||||:||.
 Frog   319 KEQRKMENISIKEQRGSRVYLPLTCKITVETELSEII---------EDLEESIMVGLHTCGDLAP 374

  Fly   277 TCLQVFHAQTDCRLLCNVGCCYHLLRERYSQQEFFGNKSLMELQ-TDYGFPLSQYLRERQVRMGR 340
            ..|::|.|:.:.:.:|:||||||||.|.:...|       .|:. |.:|||:|.:|:|.....||
 Frog   375 NTLRIFTAKPEIKAVCSVGCCYHLLSEEFESPE-------EEITVTTWGFPMSIHLKESSWFFGR 432

  Fly   341 NARMLAAQSIERTLDTKELPNVTLYYRALLEILVCRHAPELKNELQVGKV-RKFESFEEYIQKCA 404
            ||||.|..::||....:.|...:|:|||:|::::.......:::.:|||: .|..:|.||::|..
 Frog   433 NARMSACLALERVAVGQGLATESLFYRAVLQVILKDCFSVTQSDKRVGKIFSKSGNFTEYVRKSL 497

  Fly   405 TKL--DAPWLAAVEKEELQSLLQEYAVHKYFLDLFYLLRMSFAPVLESLILLDRLLYLKE---LG 464
            .||  |...|:.:   |:....::|...|..::.|.:|::..||.:|:||||||||||||   |.
 Frog   498 KKLGHDDSELSDM---EIMEYFEKYKPRKNEMEAFNMLKVLLAPCIEALILLDRLLYLKEQNNLA 559

  Fly   465 YERSYLIDLFDPVISPRHFAIVSIKQ 490
            :  |.|:.|||||.|||.:|:||:|:
 Frog   560 W--SGLVKLFDPVKSPRCYAVVSMKK 583

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33964NP_001033941.1 Methyltransf_32 122..304 CDD:290402 71/280 (25%)
mettl25XP_004912966.1 AdoMet_MTases 135..399 CDD:302624 69/277 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2651
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H32774
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007533
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.780

Return to query results.
Submit another query.