DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33964 and rrnad1

Sequence 1:NP_001033941.1 Gene:CG33964 FlyBaseID:FBgn0053964 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001039128.1 Gene:rrnad1 XenbaseID:XB-GENE-5845705 Length:596 Species:Xenopus tropicalis

Alignment Length:616 Identity:138/617 (22%)
Similarity:237/617 (38%) Gaps:182/617 (29%)


  Fly    10 QRRLDGLLAFLNPHWDFV-NCHMVNYLTDQHWDGF-------LSETLKSEIA-------GKEDVA 59
            |::|...:|.:...:.|: :.:::.:.||..|:..       ||:....|:|       |::.::
 Frog    12 QKQLAEYIARVLSVYGFITDSYIIEFFTDNLWEKLPESWRTSLSDLSSPELAEQLLSNGGRDTIS 76

  Fly    60 ---------LAIEDLFWKTDESERFP--AWREFLGKSKQERLSLHPKLLTSVEELIEGQGNSTQL 113
                     ||::    .|.....||  ...|...|:.:.           .||..|....|.:|
 Frog    77 YRSVWPLSLLALK----ATAHCLAFPRIPVNEAANKNHKR-----------PEEFCENHCQSNKL 126

  Fly   114 S--IREFMSAKKCHEVDLTAVLVDQLVKNSGQDCFIVDAGDGKGYLSSRLALQYGHRVLGIDAN- 175
            .  .|:.:..||.||:.....||..|.:.:|.: .:||.|.|:|:||..|:...|..|..::|: 
 Frog   127 DPLFRKHVKPKKQHEIRQLGKLVRILSEVTGCE-QVVDIGSGQGHLSRFLSFGQGLSVTAVEADK 190

  Fly   176 -----AANTENAL----------------NRNRKL------QRAWNGL----------------- 196
                 ||..::.|                |..|.:      :.:|..|                 
 Frog   191 HLVTMAAKFDHDLMYMLEKKSHIITDLSPNPPRHVMAWVDPKASWEDLAKQLGECSCVVNRKCGG 255

  Fly   197 ---TERAELQVQGITPKRRSKKSPAR------ESTKSAPALENYKTTAKFITTELNFGALLAENF 252
               .:|....|.|......:.::|..      .|.::||.|.        |.:..:.|  ||:: 
 Frog   256 HFKAQRIGGTVNGHADPGSTTENPGECLNVKLHSGQTAPVLG--------INSHSSHG--LAKH- 309

  Fly   253 TQFRP------------EDSPNICLTGLHTCGNLAATCLQVFHAQTDCRLLCNVGCCYHLLRERY 305
            :.|.|            ..|....|||||.||:|:...|:.|....:...:.:|.|||       
 Frog   310 SAFEPVTCSCHDGQVPYSPSDKFLLTGLHACGDLSVAMLRHFARCPNVVGITSVACCY------- 367

  Fly   306 SQQEFFGNKSLMELQT----------------------DYGFPLSQYL-RERQVRMGRNARMLAA 347
                       |:|.|                      :||:|||.:: |....::...||.:|.
 Frog   368 -----------MKLSTSEMPEPPGVLSSSHPAQATQPLEYGYPLSSWVARLPGHKLSYKAREVAC 421

  Fly   348 QSIERTLDTKELPNVTL---YYRALLEILVCRHAPELKNELQVGKVRKFES--FEEYIQKCATKL 407
            .:||..::.....:..|   .|||:||.::....|.:|.. .|..::|...  |.||.::...::
 Frog   422 HAIEDYMERLRGESAILRTHCYRAVLETVIRSIDPNMKRP-GVQTIKKAHELPFREYAREGLKRV 485

  Fly   408 DAPWLAAVEKEELQSLLQEYAVHKYFLDLFYLLRMSFAPVLESLILLDRLLYLKELGYERSYLID 472
            .......:::..::.||.::.....|..|..||    ||::|:||||||:::|:|.|:... ||.
 Frog   486 GLDPGTTLDEVLVERLLSQHQKVVAFFSLALLL----APLIETLILLDRMIFLQEQGFHCD-LIP 545

  Fly   473 LFDPVISPRHFAIVSIK---------QQTQQ 494
            ||.|..|||:..:|:.|         ||.:|
 Frog   546 LFKPEFSPRNLVLVATKAGASPVNVWQQLEQ 576

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33964NP_001033941.1 Methyltransf_32 122..304 CDD:290402 55/248 (22%)
rrnad1NP_001039128.1 AdoMet_MTases 137..372 CDD:302624 57/265 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.