DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33964 and mettl25

Sequence 1:NP_001033941.1 Gene:CG33964 FlyBaseID:FBgn0053964 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_001038522.1 Gene:mettl25 ZFINID:ZDB-GENE-041210-90 Length:590 Species:Danio rerio

Alignment Length:606 Identity:171/607 (28%)
Similarity:267/607 (44%) Gaps:144/607 (24%)


  Fly     6 VVQLQRRLDGLLAFLNPHWDFVNCHMVNYLTDQHWDGFLS---ETLKSEIAGKEDVALAIED--- 64
            :|.:::::|.:..||:......|.|.|::.|...|..|:|   |.:...|:..:|...|:|:   
Zfish     9 IVAVKKKIDEVKHFLSISLSISNAHTVDFYTRGVWSTFISVSPEDVLCAISSTQDSTGALEEKEN 73

  Fly    65 -LFWKTDESERFPAWREFLGKSKQERLSLHPKL--LTSVEELIE-----------GQGNSTQLSI 115
             .|...:.|::.......|..:|...|   |.|  ...:|||:.           ||.::..|:.
Zfish    74 TTFGFCNASKKLLDISALLRAAKAHCL---PGLGVCMQLEELMHNLRLMCGDTAAGQSSNKVLAP 135

  Fly   116 REFMSAKKCHEVDLTAVLVDQLVKNSGQDCF----IVDAGDGKGYLSSRLALQYGHRVLGIDANA 176
            .|||:.||.|||...:.:|..|.|     |.    ::|.|.|||||.|.|:::|..:|.|||::.
Zfish   136 DEFMNWKKAHEVQSMSEVVASLAK-----CCRVKQVIDVGSGKGYLCSYLSMRYNLQVFGIDSST 195

  Fly   177 ANTENALNRNRKLQR-------------------------------AWNGLTER-AELQVQG--- 206
            .||..|..|||||::                               :.|.:|:: .|.|.:.   
Zfish   196 TNTHGAQERNRKLKKFSKAYQQHRFIENNCVQSNDESREHYNESDGSKNCITKQGVEAQTESSAL 260

  Fly   207 ---------------------------------------------ITP-----------KRRSKK 215
                                                         :.|           ||.:.:
Zfish   261 SQQVTRDLLASNNAAECPLDPSDSDSGSSFLSLLALDVIEDVSLRVHPSKLSAEERERRKRENLE 325

  Fly   216 SPARESTKSAPALENYKTTAKFITTELNFGALLAENFTQFRPEDSPNICLTGLHTCGNLAATCLQ 280
            ..|||..:.......:.....::|.|.....|:.|         ..|..|.||||||:||::.|:
Zfish   326 RKAREGKRKDSNSSLFSPLTSYVTAETELKTLITE---------LENAVLVGLHTCGDLASSSLR 381

  Fly   281 VFHAQTDCRLLCNVGCCYHLLRERYSQQEFFGNKSLMELQTD--YGFPLSQYLRERQVRMGRNAR 343
            :|.|:.:.|.:|:||||||||.|.:.|..       ....:|  .|||:||||:::....|||||
Zfish   382 MFRAKQELRAVCSVGCCYHLLSEEFDQDR-------PGCTSDGVCGFPMSQYLKDQACFCGRNAR 439

  Fly   344 MLAAQSIERTLDTKELPNVTLYYRALLEILVCRHAPELKNELQVGKV-RKFESFEEYIQKCATKL 407
            |.|..::||......||..:|:|||:|.:::..|....|:|.:||.| .|..||.:|:::...||
Zfish   440 MSACLALERVSAGGGLPMESLFYRAVLHVILQDHYDCFKSEKRVGNVYSKATSFADYVRRALRKL 504

  Fly   408 DAPWLAAVEKEELQSLLQEYAVHKYFLDLFYLLRMSFAPVLESLILLDRLLYLKEL-GYERSYLI 471
            |.. .:.:...::||....|......:..|.:|:::.||.:|.|||||||.||||. ....:.|:
Zfish   505 DLD-ESKLSDGDIQSYHDRYTPRMNEMVAFNMLKVTLAPCIEGLILLDRLCYLKEQENVSHAALV 568

  Fly   472 DLFDPVISPRHFAIVSIKQQT 492
            .||||:.|||.:|:|.||:.|
Zfish   569 QLFDPLQSPRCYAVVGIKKST 589

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33964NP_001033941.1 Methyltransf_32 122..304 CDD:290402 69/277 (25%)
mettl25NP_001038522.1 AdoMet_MTases 142..405 CDD:302624 69/277 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2651
Hieranoid 1 1.000
Homologene 1 1.000 H32774
Inparanoid 1 1.050 243 1.000 Inparanoid score I3226
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007533
OrthoInspector 1 1.000 T1052547
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12496
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5160
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1110.960

Return to query results.
Submit another query.