DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG33964 and RRNAD1

Sequence 1:NP_001033941.1 Gene:CG33964 FlyBaseID:FBgn0053964 Length:484 Species:Drosophila melanogaster
Sequence 2:NP_057081.3 Gene:RRNAD1 HGNCID:24273 Length:475 Species:Homo sapiens

Alignment Length:544 Identity:146/545 (27%)
Similarity:220/545 (40%) Gaps:137/545 (25%)


  Fly     1 MSKVGVVQLQRRLDGLLAFLNPHWDFVNCHMVNYLTDQHWDGFLSETLKSEIAGKEDVALAIEDL 65
            :|..|..||...|..:||.   :...::.:::.:.||..||     ||..               
Human     9 LSHEGRKQLAVNLTRVLAL---YRSILDAYIIEFFTDNLWD-----TLPC--------------- 50

  Fly    66 FWKTDESERFPAWREFLGKSKQERL-----------------SLHPKLLTSVE------------ 101
                       :|:|.|...|..:|                 |:.|..|.:::            
Human    51 -----------SWQEALDGLKPPQLATMLLGMPGEGEVVRYRSVWPLTLLALKSTACALAFTRMP 104

  Fly   102 ------ELIEGQGNSTQLS--IREFMSAKKCHEVDLTAVLVDQLVKNSGQDCF-IVDAGDGKGYL 157
                  |.:|....|::|:  .|:.:..||.||:.....||.:|...:|  |. :||.|.|:|:|
Human   105 GFQTPSEFLENPSQSSRLTAPFRKHVRPKKQHEIRRLGELVKKLSDFTG--CTQVVDVGSGQGHL 167

  Fly   158 SSRLALQYGHRVLGIDANAANTENALNRNRKLQRAWNGLTERAELQVQGITPKRRSKKSPAREST 222
            |..:||..|..|..|:.:....|.|...:::|.:|.....:|....||  |..|.|.....|...
Human   168 SRFMALGLGLMVKSIEGDQRLVERAQRLDQELLQALEKEEKRNPQVVQ--TSPRHSPHHVVRWVD 230

  Fly   223 KSAPALENYKTTAKFITTELNFGALLAENFTQFRPEDSPNICLTGLHTCGNLAATCLQVFHAQTD 287
            .:|            :..||   .|..||..|.|    ..:.|||||.||:|:...|:.|....:
Human   231 PTA------------LCEEL---LLPLENPCQGR----ARLLLTGLHACGDLSVALLRHFSCCPE 276

  Fly   288 CRLLCNVGCCYHLLRERYSQQEFFGNKSLMELQTDYGFPLSQYLR-----ERQVRMGRNARMLAA 347
            ...|.:|||||                  |:|....|:||||::.     |...|:...|.....
Human   277 VVALASVGCCY------------------MKLSDPGGYPLSQWVAGLPGYELPYRLREGACHALE 323

  Fly   348 QSIERTLDTKELPNV-TLYYRALLEILVCRHAPELKNELQVGKVRKFE-SFEEYIQKCATK--LD 408
            :..||.  .|..|.: |..|||.||.::.|..|||:.....|..|..| ..|||:|:...:  ||
Human   324 EYAERL--QKAGPGLRTHCYRAALETVIRRARPELRRPGVQGIPRVHELKIEEYVQRGLQRVGLD 386

  Fly   409 APW---LAAVEKEELQSLLQEYAVHKYFLDLFYLLRMSFAPVLESLILLDRLLYLKELGYERSYL 470
            ...   |||         ||.:...:..:..|:.|.:..||::|:||||||||||:|.|: .:.|
Human   387 PQLPLNLAA---------LQAHVAQENRVVAFFSLALLLAPLVETLILLDRLLYLQEQGF-HAEL 441

  Fly   471 IDLFDPVISPRHFAIVSIKQQTQQ 494
            :.:|.|.:|||:..:|:.|....|
Human   442 LPIFSPELSPRNLVLVATKMPLGQ 465

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG33964NP_001033941.1 Methyltransf_32 122..304 CDD:290402 56/183 (31%)
RRNAD1NP_057081.3 Methyltransf_32 133..293 CDD:290402 58/201 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5160
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.