DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33964 and Orc3

DIOPT Version :9

Sequence 1:NP_001033941.1 Gene:CG33964 / 3772719 FlyBaseID:FBgn0053964 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_056639.3 Gene:Orc3 / 50793 MGIID:1354944 Length:715 Species:Mus musculus


Alignment Length:452 Identity:89/452 - (19%)
Similarity:182/452 - (40%) Gaps:119/452 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KEDVALAIEDLFWKTD-ESE----RFPA----WREFLGKSKQERLSLHPKLLTSVEELIEGQGNS 110
            |..|.:.|||.|...: :||    ||..    |:....:::|.:..|:..|..::.:.::.....
Mouse    26 KRKVFVPIEDYFNNEELDSEDSKLRFETYSLLWQRMKSETEQLQEELNENLFDNLVDFLQKSHPE 90

  Fly   111 TQLSIREFMSAKKCHEVDLTAVLV-------DQLVKNSGQDC------FIV-----DAGDGKGYL 157
            .|.:.|::.|..|..|:...|:::       |.::::..:..      ::|     |..|.|.:|
Mouse    91 FQKNSRDWGSQMKFREIPTAALILGVNVTDHDVILRSLTETLQNNVTPYVVSLQAKDCPDVKHFL 155

  Fly   158 ---SSRLALQYGHRVLGIDANAANTENALNRNRKLQR---------AW-NGLTERAELQVQGITP 209
               :|:|          :|.........:...:.|::         :| :.:|::|:.:|   |.
Mouse   156 QKFTSQL----------MDCCVDRHSKEVTSGKALKKTNYSMDSLCSWYSAVTQKADHKV---TI 207

  Fly   210 KRRSKKSPARESTKSAPALENYKTTAKFITTEL-NFGALLAENFTQFRPEDSPNICLTGL----- 268
            |:|:    |....:|.|.:...|:...|.:..| :|..:.:::..:|     |.|.:.|:     
Mouse   208 KKRT----ASGHWRSPPVVLILKSMESFTSKVLQDFITISSQHLHEF-----PLILIFGIATSPV 263

  Fly   269 -------HTCGNLAATCLQVFHAQTDCRLLCNVGCCYHLLRERYSQQEFFGNKSLMELQTDYGFP 326
                   |:..:|  .|:::|.         ::.|..||        ....:|.|:..|    ||
Mouse   264 IIHRLLPHSVSSL--LCVELFQ---------SLSCEQHL--------TVVLDKLLLTPQ----FP 305

  Fly   327 LSQYLRERQVRMGRNARMLAAQSIERTLDTKELPNVTLYYRALLEILVCRHAPELKNEL------ 385
            ..  |.::.:::..|..:....||:..:...:|..:..:|...|.:|.| ...|.|..:      
Mouse   306 FK--LSKKALQVLTNIFLYHDFSIQSFIKGIKLSLLEHFYSQPLSVLCC-DLSEAKKRVNVFSVS 367

  Fly   386 QVGKVRKFESFEEYIQ------KCATKLDAPWLAAVEKEELQSLLQEYAVHKYFLDLFYLLR 441
            |...:|:..||..|::      :.|...:..:|    ||:.||||::  :|.|.::.|.:||
Mouse   368 QCENIRRLPSFRRYVENQPLGKQVALLTNETFL----KEKTQSLLED--LHVYHINYFLVLR 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33964NP_001033941.1 Methyltransf_32 122..304 CDD:290402 38/225 (17%)
Orc3NP_056639.3 ORC3_N 25..350 CDD:284456 67/370 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.